HNMT Protein, Human (His)
Based on 1 Customer Validation
The HNMT protein plays a pivotal role in histamine metabolism, facilitating its inactivation through N-methylation. This enzymatic activity is crucial for histamine degradation, emphasizing HNMT's essential function in modulating histamine levels. Its involvement in regulating the airway response to histamine underscores its significance in maintaining physiological homeostasis, potentially impacting immune and inflammatory responses. HNMT Protein, Human (His) is the recombinant human-derived HNMT protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The HNMT protein plays a pivotal role in histamine metabolism, facilitating its inactivation through N-methylation. This enzymatic activity is crucial for histamine degradation, emphasizing HNMT's essential function in modulating histamine levels. Its involvement in regulating the airway response to histamine underscores its significance in maintaining physiological homeostasis, potentially impacting immune and inflammatory responses. HNMT Protein, Human (His) is the recombinant human-derived HNMT protein, expressed by E. coli , with N-His labeled tag.
Background
The HNMT protein assumes a pivotal role in histamine metabolism by facilitating its inactivation through N-methylation. This enzymatic activity is crucial for the degradation of histamine, emphasizing HNMT's essential function in modulating histamine levels. Particularly, its involvement in regulating the airway response to histamine underscores its significance in maintaining physiological homeostasis, with potential implications in immune and inflammatory responses.
Verified Bioactivity
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
P50135-1 (M1-A292)
-
Molecular Construction
-
N-term
-
His
-
HNMT (M1-A292)
Accession # P50135-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
HNMT; HNMT-S1; Histamine N-Methyltransferase; HNMT-S2; HMT; MRT51
-
AA Sequence
MASSMRSLFSDHGKYVESFRRFLNHSTEHQCMQEFMDKKLPGIIGRIGDTKSEIKILSIGGGAGEIDLQILSKVQAQYPGVCINNEVVEPSAEQIAKYKELVAKTSNLENVKFAWHKETSSEYQSRMLEKKELQKWDFIHMIQMLYYVKDIPATLKFFHSLLGTNAKMLIIVVSGSSGWDKLWKKYGSRFPQDDLCQYITSDDLTQMLDNGLKYECYDLLSTMDISDCFIDGNENGDLLWDFLTETCNFNATAPPDLRAELGKDLQEPEFSAKKEGKVLFNNTLSFIVIEA
-
Predicted Molecular Mass
33.3 kDa
-
Molecular Weight
Approximately 32 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (260 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
