HP-0175 Protein, Helicobacter pylori (GST)
HP-0175 is an antigen secreted by Helicobacter pylori. HP-0175 provides a link between helicobacter pylori-associated inflammation and gastric cancer by promoting the pro-inflammatory low-cytotoxic TIL response, stromal degradation, and pro-angiogenesis pathways. HP-0175 relies on the unfolded protein response (UPR) to autophagy in gastric epithelial cells and induce apoptosis. HP-0175 Protein, Helicobacter pylori (GST) is the recombinant HP-0175 protein, expressed by E. coli , with N-GST labeled tag.
- Species: Others
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
HP-0175 is an antigen secreted by Helicobacter pylori. HP-0175 provides a link between helicobacter pylori-associated inflammation and gastric cancer by promoting the pro-inflammatory low-cytotoxic TIL response, stromal degradation, and pro-angiogenesis pathways. HP-0175 relies on the unfolded protein response (UPR) to autophagy in gastric epithelial cells and induce apoptosis. HP-0175 Protein, Helicobacter pylori (GST) is the recombinant HP-0175 protein, expressed by E. coli , with N-GST labeled tag.
Background
HP-0175 is an antigen secreted by Helicobacter pylori. HP-0175 is a peptidyl proline cis-trans isomerase that has a part-time effect on host cells. HP-0175 may provide a link between helicobacter pylori-associated inflammation and gastric cancer by promoting pro-inflammatory, low-cytotoxic TIL responses, stromal degradation, and pro-angiogenesis pathways. HP-0175 relies on the unfolded protein response (UPR) to autophagy in gastric epithelial cells and induce apoptosis[1][2][3].
Technical Parameters
-
Species Others
-
Source E. coli
-
Tag N-GST
-
Accession
P56112 (K22-K299)
-
Gene ID/
-
Molecular Construction
-
N-term
-
GST
-
HP-0175 (K22-K299)
Accession # P56112 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
Putative peptidyl-prolyl cis-trans isomerase HP_0175; EC:5.2.1.8; PPIase HP_0175; Rotamase HP_0175; HP_0175
-
AA Sequence
KPAHNANNATHNTKKTTDSSAGVLATVDGRPITKSDFDMIKQRNPNFDFDKLKEKEKEALIDQAIRTALVENEAKTEKLDSTPEFKAMMEAVKKQALVEFWAKKQAEEVKKVQIPEKEMQDFYNANKDQLFVKQEAHARHILVKTEDEAKRIISEIDKQPKAKKEAKFIELANRDTIDPNSKNAQNGGDLGKFQKNQMAPDFSKAAFALTPGDYTKTPVKTEFGYHIIYLISKDSPVTYTYEQAKPTIKGMLQEKLFQERMNQRIEELRKHAKIVINK
-
Predicted Molecular Mass
58.8 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
