HP-0175 Protein, Helicobacter pylori (GST)

HP-0175 is an antigen secreted by Helicobacter pylori. HP-0175 provides a link between helicobacter pylori-associated inflammation and gastric cancer by promoting the pro-inflammatory low-cytotoxic TIL response, stromal degradation, and pro-angiogenesis pathways. HP-0175 relies on the unfolded protein response (UPR) to autophagy in gastric epithelial cells and induce apoptosis. HP-0175 Protein, Helicobacter pylori (GST) is the recombinant HP-0175 protein, expressed by E. coli , with N-GST labeled tag.

For research use only. We do not sell to patients.
  • Species: Others
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

HP-0175 is an antigen secreted by Helicobacter pylori. HP-0175 provides a link between helicobacter pylori-associated inflammation and gastric cancer by promoting the pro-inflammatory low-cytotoxic TIL response, stromal degradation, and pro-angiogenesis pathways. HP-0175 relies on the unfolded protein response (UPR) to autophagy in gastric epithelial cells and induce apoptosis. HP-0175 Protein, Helicobacter pylori (GST) is the recombinant HP-0175 protein, expressed by E. coli , with N-GST labeled tag.

Background

HP-0175 is an antigen secreted by Helicobacter pylori. HP-0175 is a peptidyl proline cis-trans isomerase that has a part-time effect on host cells. HP-0175 may provide a link between helicobacter pylori-associated inflammation and gastric cancer by promoting pro-inflammatory, low-cytotoxic TIL responses, stromal degradation, and pro-angiogenesis pathways. HP-0175 relies on the unfolded protein response (UPR) to autophagy in gastric epithelial cells and induce apoptosis[1][2][3].

Technical Parameters

  • Species Others
  • Source E. coli
  • Tag N-GST
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • GST
    • HP-0175 (K22-K299)
      Accession # P56112
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    Putative peptidyl-prolyl cis-trans isomerase HP_0175; EC:5.2.1.8; PPIase HP_0175; Rotamase HP_0175; HP_0175

  • AA Sequence

    KPAHNANNATHNTKKTTDSSAGVLATVDGRPITKSDFDMIKQRNPNFDFDKLKEKEKEALIDQAIRTALVENEAKTEKLDSTPEFKAMMEAVKKQALVEFWAKKQAEEVKKVQIPEKEMQDFYNANKDQLFVKQEAHARHILVKTEDEAKRIISEIDKQPKAKKEAKFIELANRDTIDPNSKNAQNGGDLGKFQKNQMAPDFSKAAFALTPGDYTKTPVKTEFGYHIIYLISKDSPVTYTYEQAKPTIKGMLQEKLFQERMNQRIEELRKHAKIVINK

  • Predicted Molecular Mass

    58.8 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00