1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interferon & Receptors
  4. IFN-γ
  5. IFN-gamma Protein, Human (143a.a, CHO)

IFN-gamma Protein, Human (143a.a, CHO)

Cat. No.: HY-P7025A
COA Handling Instructions

IFN-gamma Protein, Human (CHO) is a cytokine with potent immunomodulatory, antiviral and antitumor activities.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $60 In-stock
50 μg $120 In-stock
100 μg $170 Get quote
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IFN-gamma Protein, Human (CHO) is a cytokine with potent immunomodulatory, antiviral and antitumor activities.

Background

Human Interferon-gamma (hIFNγ) is naturally produced by CD4+ T helper cell type 1 (Th1) lymphocytes, CD8+ cytotoxic lymphocytes, natural killer (NK) cells, B cells, NKT cells, and professional antigen-presenting cells (APCs). Secretion of hIFNγ by NK cells and APCs is important in early host reactions against infection while production of hIFNγ by T lymphocytes is important in the adaptive immune response. hIFNγ shows antiviral and antitumor activity and is involved in complex interactions of cellular metabolism and differentiation[1]. Interferon-gamma (IFN-γ) is a cytokine with potent immunomodulatory propertiy. IFN-γ activates cells via a different receptor than IFN-α and IFN-β, which accounts for the different physiological properties of the proteins[2].

Biological Activity

The ED50 is <2 ng/mL as measured by HT-29 cells, corresponding to a specific activity of >5 × 105 units/mg.

Species

Human

Source

CHO

Tag

Tag Free

Accession

P01579 (Q24-Q166)

Gene ID
Synonyms
rHuIFN-γ; IFNG; IFN-gamma; Interferon gamma
AA Sequence

QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ

Molecular Weight

15-25 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

IFN-gamma Protein, Human (143a.a, CHO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IFN-gamma Protein, Human (143a.a, CHO)
Cat. No.:
HY-P7025A
Quantity:
MCE Japan Authorized Agent: