IFN-gamma Protein, Human (CHO)
Based on 8 publication(s) in Google Scholar
IFN-gamma Protein, Human (CHO) is a cytokine with potent immunomodulatory, antiviral and antitumor activities.
- Species: Human
- Source: CHO
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
IFN-gamma Protein, Human (CHO) is a cytokine with potent immunomodulatory, antiviral and antitumor activities.
Background
Human Interferon-gamma (hIFNγ) is naturally produced by CD4+ T helper cell type 1 (Th1) lymphocytes, CD8+ cytotoxic lymphocytes, natural killer (NK) cells, B cells, NKT cells, and professional antigen-presenting cells (APCs). Secretion of hIFNγ by NK cells and APCs is important in early host reactions against infection while production of hIFNγ by T lymphocytes is important in the adaptive immune response. hIFNγ shows antiviral and antitumor activity and is involved in complex interactions of cellular metabolism and differentiation[1]. Interferon-gamma (IFN-γ) is a cytokine with potent immunomodulatory propertiy. IFN-γ activates cells via a different receptor than IFN-α and IFN-β, which accounts for the different physiological properties of the proteins[2].
Verified Bioactivity
1.The ED50 is <2 ng/mL as measured in a cytotoxicity assay using HT-29 cells, corresponding to a specific activity of >5 × 105 units/mg.
2.Measured in antiviral assays using WISH cells infected with vesicular stomatitisvirus (VSV). The ED50 for this effect is 0.02-0.2 ng/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Publications (8)
-
Journal Impact Factor
-
Most Recent
-
J Transl Med
Osteopontin derived from hypoxia-induced M2 macrophages promotes osteosarcoma progression through modulation of EGR3/ISG15 signaling and RIG-I expression. [Abstract]2025 Aug 21;23(1):950. PMID: 40841904
IFN-gamma Protein, Human (CHO) purchased from MedChemExpress. Usage Cited in: J Transl Med. 2025 Aug 21;23(1):950. [Abstract]
The migratory and invasive capabilities of HOS and MG-63 cells were assessed using Transwell assays in response to normoxic or hypoxic M0, M1, and M2 macrophages. THP-1 cells underwent differentiation into M0 macrophages following 24 h exposure to 100 ng/mL phorbol 12-myristate 13-acetate (PMA, HY-18739). Following a 24 h recovery in a fresh complete medium, cells were treated with 100 ng/mL lipopolysaccharide and 20 ng/mL IFN-gamma Protein, Human (IFN-γ, HY-P7025A) for 48 h to drive M1 polarization.
-
Phytother Res
Loureirin B Accelerates Diabetic Wound Healing by Promoting TGFβ/Smad-Dependent Macrophage M2 Polarization: A Concerted Analytical Approach Through Single-Cell RNA Sequencing and Experimental Verification. [Abstract]2024 Nov 12. PMID: 39532388 -
Clin Transl Med
Single-cell sequencing combined with spatial transcriptomics reveals that the IRF7 gene in M1 macrophages inhibits the occurrence of pancreatic cancer by regulating lipid metabolism-related mechanisms. [Abstract]2024 Aug;14(8):e1799. PMID: 39118300 -
Commun Biol
Defining gastric cancer ecology: the crucial roles of TREM2+ macrophages and fibroblasts in tumor microenvironments. [Abstract]2025 Mar 28;8(1):514. PMID: 40155473 -
Int Immunopharmacol
2025 May 16:155:114632. PMID: 40215780 -
Int Immunopharmacol
Peptidomic profiling of mesenchymal stem cell-derived extracellular vesicles and anti-inflammatory activity of degraded peptides. [Abstract]2025 Apr 16:152:114452. PMID: 40096816 -
Arthritis Res Ther
Omentin-1 reduced synovial M1 macrophages through SIRT6 signaling pathway and alleviated knee osteoarthritis response in mice. [Abstract]2025 Nov 18;27(1):216. PMID: 41254811
IFN-gamma Protein, Human (CHO) purchased from MedChemExpress. Usage Cited in: Arthritis Res Ther. 2025 Nov 18;27(1):216. [Abstract]
Western blot was used to determine the relative expression of Omentin-1 protein in Raw264.7 cells. Omentin-1 promoted the transformation of Raw264.7 cells into the M2 phenotype while inhibiting the conversion to the M1 phenotype. Raw264.7 cells were induced to differentiate into M1 macrophages by LPS (10 pg/mL) and IFN-γ (IFN-gamma Protein, Human (CHO); 20 ng/mL) for 24 h, while they were induced to differentiate into M2 macrophages by IL-4 (20 ng/mL) and IL-13 (20 ng/mL). After 24 h, Omentin-1 was added to the cell culture medium, and the incubation was continued for an additional 24 h
IFN-gamma Protein, Human (CHO) purchased from MedChemExpress. Usage Cited in: Arthritis Res Ther. 2025 Nov 18;27(1):216. [Abstract]
Representative immunofluorescence images were used to observe the polarization of Raw264.7 cells into M1 macrophages (F4/80+iNOS+) F4/80 (green), iNOS (red), nucleus (blue). Raw264.7 cells were induced to differentiate into M1 macrophages by LPS (10 pg/mL) and IFN-γ (IFN-gamma Protein, Human (CHO); 20 ng/mL) for 24 h, while they were induced to differentiate into M2 macrophages by IL-4 (20 ng/mL) and IL-13 (20 ng/mL). After 24 h, Omentin-1 was added to the cell culture medium, and the incubation was continued for an additional 24 h.
IFN-gamma Protein, Human (CHO) purchased from MedChemExpress. Usage Cited in: Arthritis Res Ther. 2025 Nov 18;27(1):216. [Abstract]
RT-qPCR was employed to assess the expression levels of pro-inflammatory cytokines secreted by M1 macrophages, IL-1β, IL-6, and TNF-α in Raw264.7 cells.Raw264.7 cells were induced to differentiate into M1 macrophages by LPS (10 pg/mL) and IFN-γ (IFN-gamma Protein, Human (CHO); 20 ng/mL) for 24 h, while they were induced to differentiate into M2 macrophages by IL-4 (20 ng/mL) and IL-13 (20 ng/mL). After 24 h, Omentin-1 was added to the cell culture medium, and the incubation was continued for an additional 24 h.
IFN-gamma Protein, Human (CHO) purchased from MedChemExpress. Usage Cited in: Arthritis Res Ther. 2025 Nov 18;27(1):216. [Abstract]
Representative western blot images of SIRT6 protein. Raw264.7 cells were induced to differentiate into M1 macrophages by LPS (10 pg/mL) and IFN-γ (IFN-gamma Protein, Human (CHO); 20 ng/mL) for 24 h, while they were induced to differentiate into M2 macrophages by IL-4 (20 ng/mL) and IL-13 (20 ng/mL). After 24 h, Omentin-1 was added to the cell culture medium, and the incubation was continued for an additional 24 h.
-
Hum Cell
METTL14 knockdown augmented the polarization of M2-like macrophages to promote acute myeloid leukemia progression. [Abstract]2025 Sep 30;38(6):168. PMID: 41026373
Technical Parameters
-
Species Human
-
Source CHO
-
Tag Tag Free
-
Accession
P01579 (Q24-Q166)
-
Molecular Construction
-
N-term
-
IFN-gamma (Q24-Q166)
Accession # P01579 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IFNG; IMD69; Interferon Gamma; IFG; IFN-Gamma; IFI; Immune Interferon
-
AA Sequence
QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
-
Molecular Weight
Approximately 15-25 kDa under reduced (R) conditions, 21 kDa & kDa under non reducing (N) conditions, based on SDS-PAGE.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of PBS.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (263 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Razaghi A, et al. Review of the recombinant human interferon gamma as an immunotherapeutic: Impacts of production platforms and glycosylation. J Biotechnol. 2016 Dec 20;240:48-60. [Content Brief]
[2]. Fam CM, et al. PEGylation improves the pharmacokinetic properties and ability of interferon gamma to inhibit growth of a human tumor xenograft in athymic mice. J Interferon Cytokine Res. 2014 Oct;34(10):759-68. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)