IFN-gamma Protein, Human (CHO)

IFN-gamma Protein, Human (CHO) is a cytokine with potent immunomodulatory, antiviral and antitumor activities.

Human Interferon-gamma (hIFNγ) is naturally produced by CD4⁺ T helper cell type 1 (Th1) lymphocytes, CD8⁺ cytotoxic lymphocytes, natural killer (NK) cells, B cells, NKT cells, and professional antigen-presenting cells (APCs). Secretion of hIFNγ by NK cells and APCs is important in early host reactions against infection while production of hIFNγ by T lymphocytes is important in the adaptive immune response. hIFNγ shows antiviral and antitumor activity and is involved in complex interactions of cellular metabolism and differentiation^[1]. Interferon-gamma (IFN-γ) is a cytokine with potent immunomodulatory propertiy. IFN-γ activates cells via a different receptor than IFN-α and IFN-β, which accounts for the different physiological properties of the proteins^[2].

1.The ED₅₀ is <2 ng/mL as measured in a cytotoxicity assay using HT-29 cells, corresponding to a specific activity of >5 × 10⁵ units/mg.
2.Measured in antiviral assays using WISH cells infected with vesicular stomatitisvirus (VSV). The ED₅₀ for this effect is 0.02-0.2 ng/mL.

• 
  Measured in a cytotoxicity assay using HT-29 cells. The ED₅₀ for this effect is 0.6359 ng/mL, corresponding to a specific activity is 1.523×10⁶ Unit/mg.

Human

CHO

Tag Free

P01579 (Q24-Q166)

3458  [NCBI]

Full Length of Mature Protein

QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ

Approximately 15-25 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

• 
  ≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder

1.Lyophilized from a 0.22 μm filtered solution of PBS.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Razaghi A, et al. Review of the recombinant human interferon gamma as an immunotherapeutic: Impacts of production platforms and glycosylation. J Biotechnol. 2016 Dec 20;240:48-60.  [Content Brief]

  [2]. Fam CM, et al. PEGylation improves the pharmacokinetic properties and ability of interferon gamma to inhibit growth of a human tumor xenograft in athymic mice. J Interferon Cytokine Res. 2014 Oct;34(10):759-68.  [Content Brief]