IGFBP-6 Protein, Mouse (HEK293, His)

IGFBP-6 protein can extend the half-life of IGF and regulate its effects. It can inhibit or stimulate the growth-promoting effects of IGF. IGFBP-6 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IGFBP-6 protein, expressed by HEK293 , with C-6*His labeled tag.

IGFBP-6 protein assumes a pivotal role in regulating the activity of insulin-like growth factors (IGFs) by extending their half-life. In cell culture, IGFBP-6 has been demonstrated to exert a dual regulatory influence, capable of either inhibiting or stimulating the growth-promoting effects of IGFs. This versatile function underscores the complexity of IGFBP-6 in modulating cellular processes. Furthermore, IGFBP-6 plays a role in altering the interaction between IGFs and their cell surface receptors. Beyond its role in IGF regulation, IGFBP-6 actively participates in cellular signaling by activating the MAPK pathway and inducing cell migration. Notably, it interacts with PHB2 via its C-terminal domain, highlighting its involvement in intricate protein-protein interactions that contribute to the multifaceted cellular responses associated with growth regulation and migration.

Measured by its ability to inhibit the biological activity of IGF-I on MCF-7 human breast cancer cells. The ED₅₀ for this effect is 1.265 µg/mL, corresponding to a specific activity is 790.6 U/mg.

• 
  Measured by its ability to inhibit the biological activity of IGF-I on MCF-7 human breast cancer cells. The ED₅₀ for this effect is 1.265 µg/mL, corresponding to a specific activity is 790.6 U/mg.

Mouse

HEK293

C-6*His

P47880 (A26-G238)

16012  [NCBI]

Full Length of Mature Protein

ALAGCPGCGAGMQTGCRGGCVEEEDAGSPADGCTEAGGCLRREGQPCGVYSPKCAPGLQCQPRENEEAPLRALLIGQGRCQRARGPSEETTKESKPQGGASRSRDTNHRDRQKNPRTSAAPIRPNPVQDSEMGPCRRHLDSVLQQLQTEVFRGGARGLYVPNCDLRGFYRKQQCRSSQGNRRGPCWCVDPMGQPLPVSPDGQGSTQCSARSSG

Approximately 28 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.