2. Recombinant Proteins
  3. Fc Receptors
  4. Immunoglobulin Fc Region
  5. IgG3
  6. IgG3 Fc Protein, Mouse (HEK293)

IgG3 Fc Protein, Mouse (HEK293)

Cat. No.: HY-P70251
Handling Instructions

IgG3 Fc Protein is the high conserved Fc segment of IgG3 (Immunoglobulin G3). Mouse IgG3 Fc protein is involved in several processes, such as activation of immune response, B-cell signaling, complement activation. IgG3 Fc Protein, Mouse (HEK293) is the recombinant mouse-derived IgG3 Fc protein, expressed by HEK293 , with tag free. The total length of IgG3 Fc Protein, Mouse (HEK293) is 210 a.a., with molecular weight of ~31.0 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IgG3 Fc Protein is the high conserved Fc segment of IgG3 (Immunoglobulin G3). Mouse IgG3 Fc protein is involved in several processes, such as activation of immune response, B-cell signaling, complement activation[1][2]. IgG3 Fc Protein, Mouse (HEK293) is the recombinant mouse-derived IgG3 Fc protein, expressed by HEK293 , with tag free. The total length of IgG3 Fc Protein, Mouse (HEK293) is 210 a.a., with molecular weight of ~31.0 kDa.
Background

Human IgG consists of four subclasses: IgG1, IgG2, IgG3 and IgG4. In four subclasses, IgG3 has a relative high affinity towards each human Fcγ receptor (FcγRI, FcγRIIA/B/C, FcγRIIIA/B) and higher complement activation capacity[2]. IgG3 Fc protein is the high conserved Fc segment of IgG3 (Immunoglobulin G3). Human IgG3 Fc protein only shares about 68% aa sequence identity with mouse IgG3 Fc protein.
Species

Mouse
Source

HEK293
Tag

Tag Free
Accession

P03987-2 (E97-T306)
Gene ID

380795
Molecular Construction
N-term
IgG3 Fc (E97-T306)
Accession # P03987-2
C-term
Synonyms
rMuIg gamma-3 chain C region/IgG3 Fc; Ig gamma-3 chain C region,IgG3 Fc
AA Sequence

EPRIPKPSTPPGSSCPPGNILGGPSVFIFPPKPKDALMISLTPKVTCVVVDVSEDDPDVHVSWFVDNKEVHTAWTQPREAQYNSTFRVVSALPIQHQDWMRGKEFKCKVNNKALPAPIERTISKPKGRAQTPQVYTIPPPREQMSKKKVSLTCLVTNFFSEAISVEWERNGELEQDYKNTPPILDSDGTYFLYSKLTVDTDSWLQGEIFTCSVVHEALHNHHTQKNLSRSPGK

Molecular Weight

Approximately 31.0 kDa
Purity

Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)

IgG3 Fc Protein, Mouse (HEK293) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IgG3 Fc Protein, Mouse (HEK293)
Cat. No.:
HY-P70251
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.