1. Recombinant Proteins
  2. Fc Receptors
  3. Immunoglobulin Fc Region
  4. IgG3
  5. IgG3 Fc Protein, Mouse (HEK293)

IgG3 Fc Protein is the high conserved Fc segment of IgG3 (Immunoglobulin G3). Mouse IgG3 Fc protein is involved in several processes, such as activation of immune response, B-cell signaling, complement activation. IgG3 Fc Protein, Mouse (HEK293) is the recombinant mouse-derived IgG3 Fc protein, expressed by HEK293 , with tag free.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
10 μg 해외재고보유
50 μg 해외재고보유
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

IgG3 Fc Protein is the high conserved Fc segment of IgG3 (Immunoglobulin G3). Mouse IgG3 Fc protein is involved in several processes, such as activation of immune response, B-cell signaling, complement activation[1][2]. IgG3 Fc Protein, Mouse (HEK293) is the recombinant mouse-derived IgG3 Fc protein, expressed by HEK293 , with tag free.

Background

Human IgG consists of four subclasses: IgG1, IgG2, IgG3 and IgG4. In four subclasses, IgG3 has a relative high affinity towards each human Fcγ receptor (FcγRI, FcγRIIA/B/C, FcγRIIIA/B) and higher complement activation capacity[2]. IgG3 Fc protein is the high conserved Fc segment of IgG3 (Immunoglobulin G3). Human IgG3 Fc protein only shares about 68% aa sequence identity with mouse IgG3 Fc protein.

Species

Mouse

Source

HEK293

Tag

Tag Free

Accession

P03987-2 (E97-T306)

Gene ID

380795

Molecular Construction
N-term
IgG3 Fc (E97-T306)
Accession # P03987-2
C-term
Protein Length

Partial

Synonyms
rMuIg gamma-3 chain C region/IgG3 Fc; Ig gamma-3 chain C region,IgG3 Fc
AA Sequence

EPRIPKPSTPPGSSCPPGNILGGPSVFIFPPKPKDALMISLTPKVTCVVVDVSEDDPDVHVSWFVDNKEVHTAWTQPREAQYNSTFRVVSALPIQHQDWMRGKEFKCKVNNKALPAPIERTISKPKGRAQTPQVYTIPPPREQMSKKKVSLTCLVTNFFSEAISVEWERNGELEQDYKNTPPILDSDGTYFLYSKLTVDTDSWLQGEIFT

Predicted Molecular Mass
26.2 kDa
분자량

Approximately 31 kDa,based on SDS-PAGE under reducing conditions.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류

IgG3 Fc Protein, Mouse (HEK293) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

IgG3 Fc Protein, Mouse (HEK293)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
IgG3 Fc Protein, Mouse (HEK293)
Cat. No.:
HY-P70251
수량:
MCE Japan Authorized Agent: