Copy Link Print Information

IL-12 Protein, Cynomolgus (HEK293, His)

Customer Review

Based on 1 Customer Validation

IL-12 Protein, forming a heterodimer with IL23A, generates the cytokine IL-23, pivotal in innate and adaptive immunity. Collaborating with IL-17, IL-23 prompts an acute response to infection in peripheral tissues. Binding to the receptor complex IL12RB1 and IL23R, IL-23 activates Jak-Stat signaling, preferentially stimulates memory T-cells, and induces pro-inflammatory cytokine production. Implicated in autoimmune inflammation and tumorigenesis, IL-23 acts as a growth factor for activated T and NK cells, enhances NK cell lytic activity, and stimulates IFN-gamma production by resting PBMC. IL-12 Protein, Cynomolgus (HEK293, His) is a recombinant protein dimer complex containing cynomolgus-derived IL-12 protein, expressed by HEK293, with C-His labeled tag. IL-12 Protein, Cynomolgus (HEK293, His), has molecular weight of 45-48 kDa (IL-12B) & 38-44 kDa (IL-12A), respectively.

For research use only. We do not sell to patients.
  • Species: Cynomolgus
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • IL-12 Protein, Cynomolgus (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IL-12 Protein, forming a heterodimer with IL23A, generates the cytokine IL-23, pivotal in innate and adaptive immunity. Collaborating with IL-17, IL-23 prompts an acute response to infection in peripheral tissues. Binding to the receptor complex IL12RB1 and IL23R, IL-23 activates Jak-Stat signaling, preferentially stimulates memory T-cells, and induces pro-inflammatory cytokine production. Implicated in autoimmune inflammation and tumorigenesis, IL-23 acts as a growth factor for activated T and NK cells, enhances NK cell lytic activity, and stimulates IFN-gamma production by resting PBMC. IL-12 Protein, Cynomolgus (HEK293, His) is a recombinant protein dimer complex containing cynomolgus-derived IL-12 protein, expressed by HEK293, with C-His labeled tag. IL-12 Protein, Cynomolgus (HEK293, His), has molecular weight of 45-48 kDa (IL-12B) & 38-44 kDa (IL-12A), respectively.

Background

The IL-12 Protein forms a heterodimer with IL23A, resulting in the creation of the IL-23 interleukin, a cytokine with diverse functions in innate and adaptive immunity. In collaboration with IL-17, IL-23 may orchestrate an acute response to infection in peripheral tissues. Binding to a heterodimeric receptor complex composed of IL12RB1 and IL23R, IL-23 activates the Jak-Stat signaling cascade, preferentially stimulates memory T-cells over naive T-cells, and facilitates the production of pro-inflammatory cytokines. Furthermore, IL-23 has been implicated in inducing autoimmune inflammation, potentially playing a role in autoimmune inflammatory diseases and tumorigenesis. This cytokine acts as a growth factor for activated T and NK cells, enhances the lytic activity of NK/lymphokine-activated killer cells, and stimulates the production of IFN-gamma by resting PBMC.

Verified Bioactivity

1.Immobilized Cynomolgus IL-12, His Tag at 0.5 μg/mL(100 μl/well) on the plate. Dose response curve for Anti-IL-12 Antibody, hFc Tag with the EC50 of <8.5 ng/mL determined by ELISA.
2.Measured by its ability to enhance IFN-gamma secretion in NK-92 human natural killer lymphoma cells. The ED50 for this effect is 0.7733 ng/mL, corresponding to a specific activity is 1.293×106 U/mg.

Technical Parameters

  • Species Cynomolgus
  • Source HEK293
  • Tag C-His
  • Accession

    G7P6S2 (I23-S328)&XP_005546300.2 (R57-S253)

  • Gene ID
    /&102115316
  • Synonyms

    IL12A; Cytotoxic Lymphocyte Maturation Factor 1, P35; Prev. NKSF1; NK Cell Stimulatory Factor Chain 1; IL-12A; Interleukin-12 Alpha Chain; Interleukin-12 Subunit Alpha; Interleukin 12, P35; CLMF; IL-12, Subunit P35; NFSK; IL35 Subunit; P35; CLMF P35; Inte

  • AA Sequence

    A1:IWELKKDVYV
    VELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSGEVLGSGKTLTIQVKEFGDAGQYTCHKGGEALSHSLLLLHKKEDGIWSTDVLKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSNPQGVTCGAVTLSAERVRGDNKEYEYSVECQEDSACPAAEERLPIEVMVDAIHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCIQVQGKSKREKKDRIFTDKTSATVICRKNASFSVQAQDRYYSSSWSEWASVPCS
    A2:RNLSVATPGP
    EMFPCLHHSQNLLKAASNTLQKARQILEFYPCTSEEIDHEDITKDKTSTVEACLPLELIKNESCLNSRETSFITNGSCLASRKTSFMMALCLRSIYEDLKMYQVEFKTMNAKLLRDPKRQIFLDQNILGVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS

  • Molecular Weight

    Approximately 45-48 kDa (IL-12B) & 38-44 kDa (IL-12A), based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • IL-12 Protein, Cynomolgus (HEK293, His) Product Image
    1/16
  • IL-12 Protein, Cynomolgus (HEK293, His) Product Image