IL-12 Protein, Cynomolgus (HEK293, His)

IL-12 Protein, forming a heterodimer with IL23A, generates the cytokine IL-23, pivotal in innate and adaptive immunity. Collaborating with IL-17, IL-23 prompts an acute response to infection in peripheral tissues. Binding to the receptor complex IL12RB1 and IL23R, IL-23 activates Jak-Stat signaling, preferentially stimulates memory T-cells, and induces pro-inflammatory cytokine production. Implicated in autoimmune inflammation and tumorigenesis, IL-23 acts as a growth factor for activated T and NK cells, enhances NK cell lytic activity, and stimulates IFN-gamma production by resting PBMC. IL-12 Protein, Cynomolgus (HEK293, His) is a recombinant protein dimer complex containing cynomolgus-derived IL-12 protein, expressed by HEK293, with C-His labeled tag. IL-12 Protein, Cynomolgus (HEK293, His), has molecular weight of 45-48 kDa (IL-12B) & 38-44 kDa (IL-12A), respectively.

The IL-12 Protein forms a heterodimer with IL23A, resulting in the creation of the IL-23 interleukin, a cytokine with diverse functions in innate and adaptive immunity. In collaboration with IL-17, IL-23 may orchestrate an acute response to infection in peripheral tissues. Binding to a heterodimeric receptor complex composed of IL12RB1 and IL23R, IL-23 activates the Jak-Stat signaling cascade, preferentially stimulates memory T-cells over naive T-cells, and facilitates the production of pro-inflammatory cytokines. Furthermore, IL-23 has been implicated in inducing autoimmune inflammation, potentially playing a role in autoimmune inflammatory diseases and tumorigenesis. This cytokine acts as a growth factor for activated T and NK cells, enhances the lytic activity of NK/lymphokine-activated killer cells, and stimulates the production of IFN-gamma by resting PBMC.

1.Immobilized Cynomolgus IL-12, His Tag at 0.5 μg/mL(100 μl/well) on the plate. Dose response curve for Anti-IL-12 Antibody, hFc Tag with the EC₅₀ of <8.5 ng/mL determined by ELISA.
2.Measured by its ability to enhance IFN-gamma secretion in NK-92 human natural killer lymphoma cells. The ED₅₀ for this effect is 0.7733 ng/mL, corresponding to a specific activity is 1.293×10⁶ U/mg.

Cynomolgus

HEK293

C-His

G7P6S2 (I23-S328)&XP_005546300.2 (R57-S253)

/&102115316

A1:IWELKKDVYV
VELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSGEVLGSGKTLTIQVKEFGDAGQYTCHKGGEALSHSLLLLHKKEDGIWSTDVLKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSNPQGVTCGAVTLSAERVRGDNKEYEYSVECQEDSACPAAEERLPIEVMVDAIHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCIQVQGKSKREKKDRIFTDKTSATVICRKNASFSVQAQDRYYSSSWSEWASVPCS
A2:RNLSVATPGP
EMFPCLHHSQNLLKAASNTLQKARQILEFYPCTSEEIDHEDITKDKTSTVEACLPLELIKNESCLNSRETSFITNGSCLASRKTSFMMALCLRSIYEDLKMYQVEFKTMNAKLLRDPKRQIFLDQNILGVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS

45-48 kDa (IL-12B) & 38-44 kDa (IL-12A)

Greater than 95% as determined by Tris-Bis PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.