IL-3R alpha/CD123 Protein, Canine (283a.a, HEK293, His)

IL-3R α/CD123 protein is an important member of the type I cytokine receptor family and mediates cellular responses to a variety of cytokines, emphasizing its key role in hematopoiesis and immune regulation. IL-3R alpha/CD123 Protein, Canine (283a.a, HEK293, His) is the recombinant canine-derived IL-3R alpha/CD123 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of IL-3R alpha/CD123 Protein, Canine (283a.a, HEK293, His) is 283 a.a., with molecular weight of 42-50 kDa.

The IL-3R alpha/CD123 Protein is a crucial member of the type I cytokine receptor family, specifically categorized within the Type 5 subfamily, emphasizing its pivotal role in mediating cellular responses to various cytokines. As part of this receptor family, IL-3R alpha/CD123 likely shares conserved structural and functional features with related receptors, underscoring its involvement in transducing signals from specific type I cytokines. The classification within the type I cytokine receptor family underscores its specific designation within the broader context of cell signaling, providing insights into its unique contributions to hematopoiesis and immune regulation. The study of IL-3R alpha/CD123 contributes to our understanding of its role in physiological processes, offering potential applications in therapeutic interventions for conditions related to hematopoietic disorders and immune dysregulation. Further exploration of IL-3R alpha/CD123's role holds promise for enhancing our knowledge of its contributions to both normal cellular function and pathological conditions.

Immobilized IL-3Rα at 1 μg/mL (100 μL/well) can bind Biotinylated IL-3 protein. The ED₅₀ for this effect is 44.84 ng/mL, corresponding to a specific activity is 2.23×10^4 Unit/mg.

• 
  Measured in a cell proliferation assay using A549 cells. The ED₅₀  for this effect is 3.586 ng/mL, corresponding to a specific activity is 2.79×10⁵ units/mg.

Canine

HEK293

C-6*His

XP_038305195.1 (S33-D315)

609293  [NCBI]

SEKDPDSPIKNLRMEPGSRRLTWDLSGNVSEIKCFINSKYITKAIDSRYCQFYVLPLCEVKNFTISVKQDPPFSTGLQYVPRGAEGKPAAAARGLDCWVHDVDFLTCSWEVGRAAPGDVQYRLYWRDLKAYREQECPRYEANNRGVHVRCRFDDVSRLQRHIQFWVNGTSRRSGIPCSDLCVELPEIERLSPPHITATCNKSYSMMEWKVLSHFNHRFLYELQIQKGTDPASTEKLYENHFVIYNPGNYVAKLKVQGFFRKDWSEWSAPQLFVCDPKDEHRRD

42-50 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.