IL-6 Protein, Human (N-His)

IL-6 protein is a multifunctional cytokine that plays multiple biological functions in immunity, tissue regeneration, and metabolism. After binding to IL6R, the resulting complex binds to the signaling subunit IL6ST/gp130, triggering the intracellular IL6 signaling pathway. IL-6 Protein, Human (N-His) is the recombinant human-derived IL-6 protein, expressed by E. coli , with N-6*His labeled tag. The total length of IL-6 Protein, Human (N-His) is 184 a.a., with molecular weight of ~21 kDa.

GMP IL-6 Protein, a versatile cytokine, performs various biological functions in immunity, tissue regeneration, and metabolism. Upon binding to IL6R, the resulting complex associates with the signaling subunit IL6ST/gp130, triggering the intracellular IL6-signaling pathway. Its interaction with membrane-bound IL6R and IL6ST stimulates 'classic signaling,' while the binding of IL6 and soluble IL6R to IL6ST induces 'trans-signaling.' Moreover, 'cluster signaling' occurs when membrane-bound IL6:IL6R complexes on transmitter cells activate IL6ST receptors on neighboring receiver cells. IL-6 serves as a potent inducer of the acute phase response, rapidly mobilizing host defenses during infection and tissue injury, although excessive IL6 synthesis is implicated in disease pathology. In the innate immune response, IL-6 is synthesized by myeloid cells, such as macrophages and dendritic cells, upon recognizing pathogens through toll-like receptors at the infection or tissue injury site. In the adaptive immune response, IL-6 is essential for B-cell differentiation into immunoglobulin-secreting cells and plays a major role in the differentiation of CD4(+) T cell subsets. It is a crucial factor in the development of T follicular helper (Tfh) cells necessary for germinal-center formation and is required to drive naive CD4(+) T cells to the Th17 lineage. Additionally, IL-6 is essential for the proliferation of myeloma cells and the survival of plasmablast cells.

Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED₅₀ is 0.7347 ng/mL, corresponding to a specific activity is 1.36×10⁶ units/mg.

• 
  Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED₅₀ is 0.7347 ng/mL.

Human

E. coli

N-6*His

P05231 (P29-M212)

3569  [NCBI]

PVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Approximately 21 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween80.

<1.0 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.