ING5 Protein, Human (His)

The ING5 protein is a key component of the HBO1 complex and mediates H3K14ac and H4 acetylation. In the MOZ/MORF complex, it exhibits histone H3 acetyltransferase activity and may regulate DNA replication and act as a transcriptional coactivator. ING5 Protein, Human (His) is the recombinant human-derived ING5 protein, expressed by E. coli , with N-His labeled tag.

ING5, an integral component of the HBO1 complex, plays a crucial role in mediating the acetylation of histone H3 at 'Lys-14' (H3K14ac), and, to a lesser extent, histone H4 acetylation. Within the context of the MOZ/MORF complex, which possesses histone H3 acetyltransferase activity, ING5 contributes to chromatin acetylation, potentially regulating DNA replication and serving as a transcriptional coactivator. Functionally, ING5 inhibits cell growth, induces a delay in S-phase progression, and enhances Fas-induced apoptosis, relying on the presence of INCA1. As a versatile participant in distinct complexes, ING5 forms the HBO1 complex with KAT7/HBO1, MEAF6, and a scaffold subunit, influencing H3K14ac specificity, and the MOZ/MORF complex comprising ING5, KAT6A, KAT6B, MEAF6, and a scaffold subunit. Interactions with H3K4me3 and H3K4me2, as well as associations with EP300 and p53/TP53, further underscore the multifaceted roles of ING5 in chromatin modification and cellular processes.

Human

E. coli

N-His

Q8WYH8-2 (E36-Q84)

84289  [NCBI]

Partial

EDKKAEIDILAAEYISTVKTLSPDQRVERLQKIQNAYSKCKEYSDDKVQ

Approximately 7 kDa

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.