ING5 Protein, Human (His)

Customer Review

Based on 1 Customer Validation

The ING5 protein is a key component of the HBO1 complex and mediates H3K14ac and H4 acetylation. In the MOZ/MORF complex, it exhibits histone H3 acetyltransferase activity and may regulate DNA replication and act as a transcriptional coactivator. ING5 Protein, Human (His) is the recombinant human-derived ING5 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The ING5 protein is a key component of the HBO1 complex and mediates H3K14ac and H4 acetylation. In the MOZ/MORF complex, it exhibits histone H3 acetyltransferase activity and may regulate DNA replication and act as a transcriptional coactivator. ING5 Protein, Human (His) is the recombinant human-derived ING5 protein, expressed by E. coli , with N-His labeled tag.

Background

ING5, an integral component of the HBO1 complex, plays a crucial role in mediating the acetylation of histone H3 at 'Lys-14' (H3K14ac), and, to a lesser extent, histone H4 acetylation. Within the context of the MOZ/MORF complex, which possesses histone H3 acetyltransferase activity, ING5 contributes to chromatin acetylation, potentially regulating DNA replication and serving as a transcriptional coactivator. Functionally, ING5 inhibits cell growth, induces a delay in S-phase progression, and enhances Fas-induced apoptosis, relying on the presence of INCA1. As a versatile participant in distinct complexes, ING5 forms the HBO1 complex with KAT7/HBO1, MEAF6, and a scaffold subunit, influencing H3K14ac specificity, and the MOZ/MORF complex comprising ING5, KAT6A, KAT6B, MEAF6, and a scaffold subunit. Interactions with H3K4me3 and H3K4me2, as well as associations with EP300 and p53/TP53, further underscore the multifaceted roles of ING5 in chromatin modification and cellular processes.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His
    • ING5 (E36-Q84)
      Accession # Q8WYH8-2
    • C-term
  • Protein Length

    Partial

  • Synonyms

    ING5; Inhibitor Of Growth Protein 5; Inhibitor Of Growth Family Member 5; FLJ23842; P28ING5

  • AA Sequence

    EDKKAEIDILAAEYISTVKTLSPDQRVERLQKIQNAYSKCKEYSDDKVQ

  • Predicted Molecular Mass

    5.7 kDa

  • Molecular Weight

    Approximately 7 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00