INSL4 Protein, Human (HEK293, His)

The INSL4 protein plays a potentially critical role in the regulation of trophoblast development and bone formation. The specific mechanism of trophoblast development deserves further study. INSL4 Protein, Human (HEK293, His) is the recombinant human-derived INSL4 protein, expressed by HEK293 , with C-6*His labeled tag.

INSL4 Protein emerges as a potential key player, suggesting its crucial role in trophoblast development and the regulation of bone formation. The specific mechanisms through which INSL4 contributes to the intricate processes associated with trophoblast development remain to be fully elucidated, warranting further investigation into its functional significance in this context. Additionally, its potential involvement in the regulation of bone formation hints at a broader impact on skeletal development. The dual roles proposed for INSL4 underscore its significance in critical biological processes, prompting further research to unravel the precise molecular pathways and regulatory mechanisms through which INSL4 exerts its effects on trophoblast development and bone formation.

Human

HEK293

C-6*His

Q14641 (A26-T139)

3641  [NCBI]

Full Length of Mature Protein

AELRGCGPRFGKHLLSYCPMPEKTFTTTPGGWLLESGRPKEMVSTSNNKDGQALGTTSEFIPNLSPELKKPLSEGQPSLKKIILSRKKRSGRHRFDPFCCEVICDDGTSVKLCT

Approximately 9.0 kDa

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.