INSL4 Protein, Human (HEK293, His)
Based on 1 Customer Validation
The INSL4 protein plays a potentially critical role in the regulation of trophoblast development and bone formation. The specific mechanism of trophoblast development deserves further study. INSL4 Protein, Human (HEK293, His) is the recombinant human-derived INSL4 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The INSL4 protein plays a potentially critical role in the regulation of trophoblast development and bone formation. The specific mechanism of trophoblast development deserves further study. INSL4 Protein, Human (HEK293, His) is the recombinant human-derived INSL4 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
INSL4 Protein emerges as a potential key player, suggesting its crucial role in trophoblast development and the regulation of bone formation. The specific mechanisms through which INSL4 contributes to the intricate processes associated with trophoblast development remain to be fully elucidated, warranting further investigation into its functional significance in this context. Additionally, its potential involvement in the regulation of bone formation hints at a broader impact on skeletal development. The dual roles proposed for INSL4 underscore its significance in critical biological processes, prompting further research to unravel the precise molecular pathways and regulatory mechanisms through which INSL4 exerts its effects on trophoblast development and bone formation.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
Q14641 (A26-T139)
-
Molecular Construction
-
N-term
-
INSL4 (A26-T139)
Accession # Q14641 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
INSL4; Insulin-Like Peptide 4; Insulin Like 4; Early Placenta Insulin-Like Peptide (EPIL); EPIL; PLACENTIN; Early Placenta Insulin-Like Peptide; Placentin; Insulin-Like 4 (Placenta)
-
AA Sequence
AELRGCGPRFGKHLLSYCPMPEKTFTTTPGGWLLESGRPKEMVSTSNNKDGQALGTTSEFIPNLSPELKKPLSEGQPSLKKIILSRKKRSGRHRFDPFCCEVICDDGTSVKLCT
-
Predicted Molecular Mass
13.6 kDa
-
Molecular Weight
Approximately 9 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
