KCNJ10 Protein, Human (Cell-Free, His)

The KCNJ10 protein is an inwardly rectifying potassium channel that is essential for potassium buffering by glial cells in the brain. It favors potassium influx rather than efflux, and the voltage dependence is regulated by extracellular potassium levels. KCNJ10 Protein, Human (Cell-Free, His) is the recombinant human-derived KCNJ10 protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of KCNJ10 Protein, Human (Cell-Free, His) is 379 a.a., with molecular weight of 48.6 kDa.

The KCNJ10 protein is implicated in the potassium buffering actions of glial cells within the brain. As an inward rectifier potassium channel, it exhibits a greater inclination to permit potassium influx into the cell rather than efflux. The voltage dependence of these channels is modulated by extracellular potassium concentrations, with an upward shift in the voltage range of channel opening in response to elevated external potassium levels. The inward rectification is primarily attributed to the inhibition of outward current by internal magnesium. Furthermore, the KCNJ10 protein can be obstructed by extracellular barium and cesium. In the kidney, it collaborates with KCNJ16 to facilitate basolateral K(+) recycling in distal tubules, a process crucial for sodium (Na(+)) reabsorption. This protein forms a heterodimer with Kir5.1/KCNJ16, a requisite interaction for the localization of KCNJ16 to the basolateral membrane in kidney cells. Additionally, KCNJ10 interacts with MAGI1, both independently and possibly as a heterodimer with KCNJ16, potentially aiding in the expression of KCNJ10/KCNJ16 potassium channels at the basolateral membrane in kidney cells. Furthermore, it interacts with PATJ, suggesting a broader role in cellular interactions and membrane localization.

Human

E. coli Cell-free

N-10*His

P78508 (M1-V379)

3766

MTSVAKVYYSQTTQTESRPLMGPGIRRRRVLTKDGRSNVRMEHIADKRFLYLKDLWTTFIDMQWRYKLLLFSATFAGTWFLFGVVWYLVAVAHGDLLELDPPANHTPCVVQVHTLTGAFLFSLESQTTIGYGFRYISEECPLAIVLLIAQLVLTTILEIFITGTFLAKIARPKKRAETIRFSQHAVVASHNGKPCLMIRVANMRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVTFQVDTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV

48.6 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.