KCNJ10 Protein, Mouse (Cell-Free, His)

The KCNJ10 protein regulates potassium buffering in brain glial cells, favoring potassium influx due to its inward rectifying properties. Extracellular potassium concentration modulates its voltage dependence, and internal magnesium induces inward rectification by blocking outward current. KCNJ10 Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived KCNJ10 protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of KCNJ10 Protein, Mouse (Cell-Free, His) is 379 a.a., with molecular weight of 48.5 kDa.

The KCNJ10 protein is potentially responsible for the potassium buffering action in glial cells within the brain. As an inward rectifier potassium channel, it exhibits a greater tendency to allow potassium influx rather than efflux, and its voltage dependence is modulated by extracellular potassium concentrations. The inward rectification primarily results from the blockage of outward current by internal magnesium, and its function can be impeded by extracellular barium and cesium. In the kidney, KCNJ10, in conjunction with KCNJ16, facilitates basolateral K(+) recycling in distal tubules, a process critical for Na(+) reabsorption. Furthermore, KCNJ10 forms a heterodimer with Kir5.1/KCNJ16, essential for the localization of KCNJ16 to the basolateral membrane in kidney cells. Interactions with MAGI1, both individually and potentially as a heterodimer with KCNJ16, may contribute to KCNJ10/KCNJ16 potassium channel expression at the basolateral membrane in kidney cells. Additionally, KCNJ10 interacts with PATJ.

Mouse

E. coli Cell-free

N-10*His

Q9JM63 (M1-V379)

16513

MTSVAKVYYSQTTQTESRPLVAPGIRRRRVLTKDGRSNVRMEHIADKRFLYLKDLWTTFIDMQWRYKLLLFSATFAGTWFLFGVVWYLVAVAHGDLLELGPPANHTPCVVQVHTLTGAFLFSLESQTTIGYGFRYISEECPLAIVLLIAQLVLTTILEIFITGTFLAKIARPKKRAETIRFSQHAVVASHNGKPCLMIRVANMRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVTFQVDTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV

48.5 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.