KCNJ10 Protein, Rat (Cell-Free, His)

The KCNJ10 protein is an inwardly rectifying potassium channel that plays a critical buffering role in potassium in brain glial cells. It facilitates the influx of potassium and is regulated at extracellular levels. KCNJ10 Protein, Rat (Cell-Free, His) is the recombinant rat-derived KCNJ10 protein, expressed by E. coli Cell-free , with N-6*His labeled tag. The total length of KCNJ10 Protein, Rat (Cell-Free, His) is 379 a.a., with molecular weight of 46.6 kDa.

The KCNJ10 protein is implicated in the potassium buffering actions of glial cells in the brain. As an inward rectifier potassium channel, KCNJ10 exhibits a pronounced preference for allowing potassium influx into the cell rather than efflux. Its voltage dependence is finely tuned by extracellular potassium concentrations, resulting in a shift to more positive voltages as external potassium levels rise. The inward rectification mechanism is primarily attributed to the blockade of outward current by internal magnesium and can be impeded by extracellular barium and cesium. In the kidney, KCNJ10 collaborates with KCNJ16 to mediate basolateral K(+) recycling in distal tubules, a process crucial for Na(+) reabsorption. Forming a heterodimer with Kir5.1/KCNJ16, KCNJ10 ensures the necessary interaction for the localization of KCNJ16 to the basolateral membrane in kidney cells. Additionally, KCNJ10 interacts with MAGI1, both independently and possibly as a heterodimer with KCNJ16, potentially facilitating the expression of KCNJ10/KCNJ16 potassium channels at the basolateral membrane in kidney cells. Furthermore, KCNJ10 interacts with PATJ, hinting at its broader involvement in cellular interactions and membrane localization.

Rat

E. coli Cell-free

N-6*His

P49655 (M1-V379)

29718

MTSVAKVYYSQTTQTESRPLVAPGIRRRRVLTKDGRSNVRMEHIADKRFLYLKDLWTTFIDMQWRYKLLLFSATFAGTWFLFGVVWYLVAVAHGDLLELGPPANHTPCVVQVHTLTGAFLFSLESQTTIGYGFRYISEECPLAIVLLIAQLVLTTILEIFITGTFLAKIARPKKRAETIRFSQHAVVAYHNGKLCLMIRVANMRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVTFQVDTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYVADFSLFDQVVKVASPGGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV

46.6 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.