KCNK13 Protein, Human (Cell-Free, His)

KCNK13 Protein, a potassium channel, uniquely features weak inward rectification in symmetrical K(+) solution. As a homodimer, it regulates potassium ion flow across cellular membranes, impacting cellular excitability and membrane potential. This property highlights KCNK13's role in shaping electrochemical gradients, influencing processes reliant on potassium ion dynamics. KCNK13 Protein, Human (Cell-Free, His) is the recombinant human-derived KCNK13 protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of KCNK13 Protein, Human (Cell-Free, His) is 408 a.a., with molecular weight of 51.4 kDa.

KCNK13 Protein, a potassium channel, exhibits a distinct functional profile characterized by weak inward rectification in symmetrical K(+) solution. As a homodimer, KCNK13 contributes to the regulation of potassium ion flow across cellular membranes, playing a role in the modulation of cellular excitability and membrane potential. This unique property of weak inward rectification underscores KCNK13's involvement in shaping the electrochemical gradients across cell membranes, ultimately influencing cellular processes that rely on potassium ion dynamics.

Human

E. coli Cell-free

N-10*His

Q9HB14 (M1-R408)

56659

MAGRGFSWGPGHLNEDNARFLLLAALIVLYLLGGAAVFSALELAHERQAKQRWEERLANFSRGHNLSRDELRGFLRHYEEATRAGIRVDNVRPRWDFTGAFYFVGTVVSTIGFGMTTPATVGGKIFLIFYGLVGCSSTILFFNLFLERLITIIAYIMKSCHQRQLRRRGALPQESLKDAGQCEVDSLAGWKPSVYYVMLILCTASILISCCASAMYTPIEGWSYFDSLYFCFVAFSTIGFGDLVSSQNAHYESQGLYRFANFVFILMGVCCIYSLFNVISILIKQSLNWILRKMDSGCCPQCQRGLLRSRRNVVMPGSVRNRCNISIETDGVAESDTDGRRLSGEMISMKDLLAANKASLAILQKQLSEMANGCPHQTSTLARDNEFSGGVGAFAIMNNRLAETSGDR

51.4 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.