2. Recombinant Proteins
  3. Others
  4. KCNK9 Protein, Human (Cell-Free, His)

KCNK9 Protein, Human (Cell-Free, His)

Cat. No.: HY-P702348
Handling Instructions

KCNK9 Protein, a pH-dependent background potassium channel, usually forms homodimers and may also heterodimerize with KCNK1. KCNK9 Protein, Human (Cell-Free, His) is the recombinant human-derived KCNK9 protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of KCNK9 Protein, Human (Cell-Free, His) is 374 a.a., with molecular weight of 48.3 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

KCNK9 Protein, a pH-dependent background potassium channel, usually forms homodimers and may also heterodimerize with KCNK1. KCNK9 Protein, Human (Cell-Free, His) is the recombinant human-derived KCNK9 protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of KCNK9 Protein, Human (Cell-Free, His) is 374 a.a., with molecular weight of 48.3 kDa.
Background

KCNK9 Protein functions as a pH-dependent, voltage-insensitive background potassium channel. It typically forms homodimers, and there is evidence suggesting it can also heterodimerize with KCNK1.
Species

Human
Source

E. coli Cell-free
Tag

N-10*His
Accession

Q9NPC2 (M1-V374)
Gene ID

51305
Molecular Construction
N-term
10*His
KCNK9 (M1-V374)
Accession # Q9NPC2
C-term
Synonyms
Potassium channel subfamily K member 9; Acid-sensitive potassium channel protein TASK-3; TWIK-related acid-sensitive K(+) channel 3; Two pore potassium channel KT3.2; Two pore K(+) channel KT3.2
AA Sequence

MKRQNVRTLSLIVCTFTYLLVGAAVFDALESDHEMREEEKLKAEEIRIKGKYNISSEDYRQLELVILQSEPHRAGVQWKFAGSFYFAITVITTIGYGHAAPGTDAGKAFCMFYAVLGIPLTLVMFQSLGERMNTFVRYLLKRIKKCCGMRNTDVSMENMVTVGFFSCMGTLCIGAAAFSQCEEWSFFHAYYYCFITLTTIGFGDYVALQTKGALQKKPLYVAFSFMYILVGLTVIGAFLNLVVLRFLTMNSEDERRDAEERASLAGNRNSMVIHIPEEPRPSRPRYKADVPDLQSVCSCTCYRSQDYGGRSVAPQNSFSAKLAPHYFHSISYKIEEISPSTLKNSLFPSPISSISPGLHSFTDHQRLMKRRKSV

Molecular Weight

48.3 kDa
Purity

Greater than 90% as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)

KCNK9 Protein, Human (Cell-Free, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
KCNK9 Protein, Human (Cell-Free, His)
Cat. No.:
HY-P702348
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.