2. Recombinant Proteins
  3. Others
  4. KCSA Protein, Streptomyces coelicolor (Cell-Free, His)

KCSA Protein, Streptomyces coelicolor (Cell-Free, His)

Cat. No.: HY-P702351
Handling Instructions

KCSA Protein, a pH-gated potassium ion channel, uniquely opens in response to cytosolic pH changes, particularly from 7 to 4. This homotetrameric molecular gatekeeper facilitates pH-dependent passage of potassium ions. KCSA Protein, Streptomyces coelicolor (Cell-Free, His) is the recombinant KCSA protein, expressed by E. coli Cell-free, with N-10*His labeled tag. The total length of KCSA Protein, Streptomyces coelicolor (Cell-Free, His) is 160 a.a., with molecular weight of 23.7 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

KCSA Protein, a pH-gated potassium ion channel, uniquely opens in response to cytosolic pH changes, particularly from 7 to 4. This homotetrameric molecular gatekeeper facilitates pH-dependent passage of potassium ions. KCSA Protein, Streptomyces coelicolor (Cell-Free, His) is the recombinant KCSA protein, expressed by E. coli Cell-free, with N-10*His labeled tag. The total length of KCSA Protein, Streptomyces coelicolor (Cell-Free, His) is 160 a.a., with molecular weight of 23.7 kDa.
Background

KCSA Protein functions as a pH-gated potassium ion channel, demonstrating a unique ability to open in response to changes in cytosolic pH, with the channel opening when the pH shifts from 7 to 4. This homotetrameric protein serves as a molecular gatekeeper, allowing the passage of potassium ions in a pH-dependent manner.
Species

Others
Source

E. coli Cell-free
Tag

N-10*His
Accession

P0A333 (M1-R160)
Gene ID

/
Molecular Construction
N-term
10*His
KCSA (M1-R160)
Accession # P0A333
C-term
Synonyms
pH-gated potassium channel KcsA
AA Sequence

MPPMLSGLLARLVKLLLGRHGSALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERRGHFVRHSEKAAEEAYTRTTRALHERFDRLERMLDDNRR

Molecular Weight

23.7 kDa
Purity

Greater than 90% as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)

KCSA Protein, Streptomyces coelicolor (Cell-Free, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
KCSA Protein, Streptomyces coelicolor (Cell-Free, His)
Cat. No.:
HY-P702351
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.