Copy Link Print Information

KDELR2 Protein, Mouse (Cell-Free, His)

Customer Review

Based on 1 Customer Validation

KDELR2 Protein, a membrane receptor, crucially maintains endoplasmic reticulum (ER) resident proteins' localization. It binds the K-D-E-L sequence motif, retaining these proteins within the ER. This interaction facilitates vesicle-mediated recycling, ensuring proper subcellular localization through Golgi-to-ER protein return. KDELR2's pH-dependent binding, optimal at pH 5-5.4, underscores the regulatory role of pH in this vital cellular process. KDELR2 Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived KDELR2 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli Cell-free
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • KDELR2 Protein, Mouse (Cell-Free, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

KDELR2 Protein, a membrane receptor, crucially maintains endoplasmic reticulum (ER) resident proteins' localization. It binds the K-D-E-L sequence motif, retaining these proteins within the ER. This interaction facilitates vesicle-mediated recycling, ensuring proper subcellular localization through Golgi-to-ER protein return. KDELR2's pH-dependent binding, optimal at pH 5-5.4, underscores the regulatory role of pH in this vital cellular process. KDELR2 Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived KDELR2 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.

Background

KDELR2 Protein, a membrane receptor, functions as a crucial participant in the maintenance of endoplasmic reticulum (ER) resident proteins' localization. The receptor binds to the K-D-E-L sequence motif located in the C-terminal region of these proteins, facilitating their retention within the ER. This interaction is pivotal for the vesicle-mediated recycling process that ensures the return of ER-resident proteins from the Golgi apparatus to the ER, contributing to their proper subcellular localization. Notably, the binding affinity of KDELR2 is pH-dependent, with optimal binding occurring at a slightly acidic pH range of 5-5.4, underscoring the regulatory role of pH in this vital cellular process.

Technical Parameters

  • Species Mouse
  • Source E. coli Cell-free
  • Tag N-10*His
  • Accession

    Q9CQM2 (M1-A212)

  • Gene ID
    66913
  • Molecular Construction
    • N-term
    • 10*His
    • KDELR2 (M1-A212)
      Accession # Q9CQM2
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    KDELR2; ERD2-Like Protein 1; KDEL Endoplasmic Reticulum Protein Retention Receptor 2; KDEL Receptor 2; ERD2.2; (Lys-Asp-Glu-Leu) Endoplasmic Reticulum Protein Retention Receptor 2; ELP-1; ERD-2-Like Protein; KDEL (Lys-Asp-Glu-Leu) Endoplasmic Reticulum Pr

  • AA Sequence

    MNIFRLTGDLSHLAAIVILLLKIWKTRSCAGISGKSQLLFALVFTTRYLDLFTSFISLYNTSMKLIYIACSYATVYLIYMKFKATYDGNHDTFRVEFLVVPVGGLSFLVNHDFSPLEILWTFSIYLESVAILPQLFMISKTGEAETITTHYLFFLGLYRALYLVNWIWRFYFEGFFDLIAVVAGVVQTILYCDFFYLYITKVLKGKKLSLPA

  • Predicted Molecular Mass

    26 kDa

  • Molecular Weight

    Approximately 24 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 0.05% Brij-78, 6%trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • KDELR2 Protein, Mouse (Cell-Free, His) Product Image
    1/16
  • KDELR2 Protein, Mouse (Cell-Free, His) Product Image