KIR2DS3 Protein, Human (P.pastoris, His)

KIR2DS3, present on NK cells, selectively recognizes HLA-C alleles. In contrast to inhibitory KIRs, KIR2DS3 lacks inhibitory effects on NK cell activity. Its role is likely in activating or modulating NK cell functions, contributing to the nuanced balance of signals regulating the immune response. KIR2DS3 Protein, Human (P.pastoris, His) is the recombinant human-derived KIR2DS3 protein, expressed by P. pastoris , with N-His labeled tag. The total length of KIR2DS3 Protein, Human (P.pastoris, His) is 224 a.a., with molecular weight of ~26.7 kDa.

KIR2DS3, expressed on natural killer (NK) cells, serves as a receptor specifically recognizing HLA-C alleles. In contrast to inhibitory KIRs, KIR2DS3 does not exert inhibitory effects on NK cell activity. Instead, it likely plays a role in activating or modulating NK cell functions, contributing to the intricate balance of signals that regulate the immune response.

Human

P. pastoris

N-His

Q14952 (22H-245H)

3808  [NCBI]

HEGFRRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGTFNDTLRLIGEHIDGVSKANFSIGRMRQDLAGTYRCYGSVPHSPYQFSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSWSSYDMYHLSTEGEAHERRFSAGPKVNGTFQADFPLGPATQGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLH

Approximately 26.7 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.