Lgt Protein, Lactococcus lactis subsp. lactis (Cell-Free, His)

Lgt protein is a key enzyme that catalyzes key steps in triacylglycerol synthesis using diacylglycerol and fatty acyl-CoA. Lgt is highly expressed in small intestinal epithelial cells and is critical for dietary fat absorption. Lgt Protein, Lactococcus lactis subsp. lactis (Cell-Free, His) is the recombinant Lgt protein, expressed by E. coli Cell-free , with C-6*His labeled tag. The total length of Lgt Protein, Lactococcus lactis subsp. lactis (Cell-Free, His) is 261 a.a., with molecular weight of 32.6 kDa.

DGAT1 protein serves as a key enzyme in cellular metabolism by catalyzing the terminal and only committed step in triacylglycerol synthesis. Utilizing diacylglycerol and fatty acyl CoA as substrates, DGAT1 plays a crucial role in various physiological processes. It is highly expressed in the epithelial cells of the small intestine, where its activity is essential for the absorption of dietary fats. In the liver, DGAT1 contributes to the esterification of exogenous fatty acids to glycerol, playing a vital role in fat synthesis for storage. Additionally, it is present in female mammary glands, participating in the production of fat in milk. While DGAT1 may be involved in very low-density lipoprotein (VLDL) assembly, it is not indispensable for survival in contrast to DGAT2. The protein also functions as the major acyl-CoA retinol acyltransferase (ARAT) in the skin, contributing to the maintenance of retinoid homeostasis and preventing retinoid toxicity that could lead to skin and hair disorders. Moreover, DGAT1 exhibits versatile acyltransferase activities, including acyl CoA:monoacylglycerol acyltransferase (MGAT), wax monoester, and wax diester synthases. Notably, it can use 1-monoalkylglycerol as an acyl acceptor for the synthesis of monoalkyl-monoacylglycerol.

Others

E. coli Cell-free

C-6*His

Q9CHU9 (M1-N261)

69712606

MNNLFPFLALNKIALQLGPLAIHWYAIFIVGGAALAVWLACKEAPKRNIKTDDIIDFVLFAFPLGIVGARLYYVIFQWSYYSQHPSQIIAMWDGGGAIYGSLIAGAIVLFVFSYYRMIHPLDLLDITIPGVFLAQAMGRWGNFVNQEAYGKIVSNLDWLPAFIRNQMFIDGHYRMPTFLFESIGTLSGFILVMVFRHRIKGLKRGDIFSFYLVWYGAVRFIVEGMRTDSLMLGPARVSQWLSVLLVIVGLVLFIYRRMKKN

32.6 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.