LIF Protein, Mouse
Based on 5 publication(s) in Google Scholar
LIF Protein, Mouse is a lymphoid factor involved in various neural and inflammatory processes such as the acute-phase reaction, tissue damage, and infection.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
LIF Protein, Mouse is a lymphoid factor involved in various neural and inflammatory processes such as the acute-phase reaction, tissue damage, and infection.
Leukemia Inhibitory Factor (LIF) has been shown to possess a remarkable variety of actions. It releases calcium from bone tissue, and is the differentiation inhibitory factor preventing spontaneous differentiation in normal embryonic stem cells[1]. Leukemia inhibitory factor (LIF) is involved in both the neural and immune responses to injury. Its levels are increased in a variety of animal and human inflammatory conditions. Administration of Leukemia Inhibitory Factor can suppress inflammatory signs in some cases, for instance after intratracheal lipopolysaccharide-induced inflammation. Leukemia Inhibitory Factor also increases corticosterone levels via the hypothalamo-pituitary-adrenal axis. Exogenously added Leukemia Inhibitory Factor induces acute phase protein expression and stimulates the production of proinflammatory cytokines and monocyte chemoattractants[2]. In the hematopoietic system, LIF induces the differentiation of certain leukemic cells and the proliferation of hematopoietic stem cells, megakaryocyte progenitor cells and DA1 cells. LIF also has activity in bone remodelling, induction of the acute phase response in hepatocytes, inhibition of adipogenesis, regulation of nerve differentiation and inhibition of kidney epithelial cell differentiation[3].
1.The ED50 is <0.01 ng/mL as measured by M1 cells, corresponding to a specific activity of >1.0 × 108 units/mg.
2.Measured by its ability to induce IL-6 secretion by M-NFS-60 mouse cells. The ED50 for this effect is 2.407 ng/mL, corresponding to a specific activity is 4.15×105 U/mg.
3.Measured in a cell proliferation assay using C2C12 cell. The ED50 for this effect is 0.1-0.8 ng/mL.
-
Measured by its ability to induce IL-6 secretion by M-NFS-60 mouse cells.The ED50 for this effect is 2.407 ng/mL, corresponding to a specific activity is 4.15×105 U/mg.
Publications (5)
-
Journal Impact Factor
-
Most Recent
-
Adv Sci (Weinh)
Metabolic Imbalance Triggers Adaptive Remodeling to Accelerate Diploidization in Murine Haploid Embryonic Stem Cells. [Abstract]2026 Apr 22:e22570. PMID: 42018132 -
Eur J Pharm Sci
Velvet antler polypeptide-loaded polyvinyl alcohol-sodium alginate hydrogels promote the differentiation of neural progenitor cells in 3D towards oligodendrocytes in vitro. [Abstract]2021 Dec 1:167:106003. PMID: 34517106 -
Hum Mol Genet
Mutation in Eftud2 causes craniofacial defects in mice via mis-splicing of Mdm2 and increased P53. [Abstract]2021 May 28;30(9):739-757. PMID: 33601405 -
-
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag Tag Free
-
Accession
P09056 (S24-F203)
-
Molecular Construction
-
N-term
-
LIF (S24-F203)
Accession # P09056 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
rMuLIF; Differentiation-stimulating Factor; D factor; MLPLI
-
AA Sequence
SPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF
-
Predicted Molecular Mass
20 kDa
-
Molecular Weight
Approximately 18-20 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
-
≥ 95%, as determined by reducing SDS-PAGE.
-
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris, 150 mM NaCl, pH 8.0.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
3.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCL, pH 8.0.
4.Lyophilized from a 0.22 μm filtered solution of PBS, 8% trehalose, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (263 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Metcalf D, et al. Effects of injected leukemia inhibitory factor on hematopoietic and other tissues in mice. Blood. 1990 Jul 1;76(1):50-6. [Content Brief]
[2]. Banner LR, et al. Leukemia inhibitory factor is an anti-inflammatory and analgesic cytokine. J Neurosci. 1998 Jul 15;18(14):5456-62. [Content Brief]
[3]. Gearing DP, et al. Leukemia inhibitory factor receptor is structurally related to the IL-6 signal transducer, gp130. EMBO J. 1991 Oct;10(10):2839-48. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
