LIF Protein, Mouse

LIF Protein, Mouse is a lymphoid factor involved in various neural and inflammatory processes such as the acute-phase reaction, tissue damage, and infection.

Leukemia Inhibitory Factor (LIF) has been shown to possess a remarkable variety of actions. It releases calcium from bone tissue, and is the differentiation inhibitory factor preventing spontaneous differentiation in normal embryonic stem cells^[1]. Leukemia inhibitory factor (LIF) is involved in both the neural and immune responses to injury. Its levels are increased in a variety of animal and human inflammatory conditions. Administration of Leukemia Inhibitory Factor can suppress inflammatory signs in some cases, for instance after intratracheal lipopolysaccharide-induced inflammation. Leukemia Inhibitory Factor also increases corticosterone levels via the hypothalamo-pituitary-adrenal axis. Exogenously added Leukemia Inhibitory Factor induces acute phase protein expression and stimulates the production of proinflammatory cytokines and monocyte chemoattractants^[2]. In the hematopoietic system, LIF induces the differentiation of certain leukemic cells and the proliferation of hematopoietic stem cells, megakaryocyte progenitor cells and DA1 cells. LIF also has activity in bone remodelling, induction of the acute phase response in hepatocytes, inhibition of adipogenesis, regulation of nerve differentiation and inhibition of kidney epithelial cell differentiation^[3].

1.The ED₅₀ is <0.01 ng/mL as measured by M1 cells, corresponding to a specific activity of >1.0 × 10⁸ units/mg.
2.Measured by its ability to induce IL-6 secretion by M-NFS-60 mouse cells. The ED₅₀ for this effect is 2.407 ng/mL, corresponding to a specific activity is 4.15×10⁵ U/mg.

• 
  Measured by its ability to induce IL-6 secretion by M-NFS-60 mouse cells.The ED₅₀ for this effect is 2.407 ng/mL, corresponding to a specific activity is 4.15×10⁵ U/mg.

Mouse

E. coli

Tag Free

P09056 (S24-F203)

16878  [NCBI]

SPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAFSPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPF

Approximately 19.9 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized after extensive dialysis against 50 mM Tris, 150 mM NaCl, pH 8.0 or 20mM PB, 150mM NaCl, pH 7.4，50 mM Tris-HCL, 300 mM NaCL, pH 8.0.

<1EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Metcalf D, et al. Effects of injected leukemia inhibitory factor on hematopoietic and other tissues in mice. Blood. 1990 Jul 1;76(1):50-6.  [Content Brief]

  [2]. Banner LR, et al. Leukemia inhibitory factor is an anti-inflammatory and analgesic cytokine. J Neurosci. 1998 Jul 15;18(14):5456-62.  [Content Brief]

  [3]. Gearing DP, et al. Leukemia inhibitory factor receptor is structurally related to the IL-6 signal transducer, gp130. EMBO J. 1991 Oct;10(10):2839-48.  [Content Brief]