1. Recombinant Proteins
  2. CD Antigens Receptor Proteins
  3. NK Cell CD Proteins Leukocyte Immunoglobin-like Receptors
  4. LIR-9/CD85f LIR-9/CD85f
  5. LILRA5/CD85f Protein, Rat (HEK293, His)

The LILRA5/CD85f protein is predicted to have inhibitory MHC class I receptor activity and may modulate immune responses. Involved in the MAPK cascade and regulation of cytokine production, expected to be active on the cell surface and extracellular space, and in the plasma membrane. LILRA5/CD85f Protein, Rat (HEK293, His) is the recombinant rat-derived LILRA5/CD85f protein, expressed by HEK293 , with C-His labeled tag. The total length of LILRA5/CD85f Protein, Rat (HEK293, His) is 232 a.a., with molecular weight of ~37 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The LILRA5/CD85f protein is predicted to have inhibitory MHC class I receptor activity and may modulate immune responses. Involved in the MAPK cascade and regulation of cytokine production, expected to be active on the cell surface and extracellular space, and in the plasma membrane. LILRA5/CD85f Protein, Rat (HEK293, His) is the recombinant rat-derived LILRA5/CD85f protein, expressed by HEK293 , with C-His labeled tag. The total length of LILRA5/CD85f Protein, Rat (HEK293, His) is 232 a.a., with molecular weight of ~37 kDa.

Background

LILRA5/CD85f Protein is predicted to possess inhibitory MHC class I receptor activity, indicating its potential role in immune modulation. Predicted to participate in processes such as positive regulation of the MAPK cascade, positive regulation of protein tyrosine kinase activity, and the regulation of cytokine production, this protein is expected to be located on the cell surface and in the extracellular space, with predicted activity in the plasma membrane. LILRA5 is orthologous to several human genes, including LILRA5 (leukocyte immunoglobulin-like receptor A5), suggesting evolutionary conservation of its functions. The protein demonstrates biased expression, with significant levels observed in the Spleen (RPKM 160.9), Liver (RPKM 62.0), and seven other tissues, underscoring its potential importance in immune-related processes across various tissues.

Biological Activity

Measured by its binding ability in a functional ELISA. When Recombinant Human LILRA5/CD85f is coated at 2 µg/mL can bind ANGPTL7. The ED50 for this effect is 0.5874 μg/mL.

  • Measured by its binding ability in a functional ELISA. When Recombinant Human LILRA5/CD85f is coated at 2 µg/mL can bind ANGPTL7. The ED50 for this effect is 0.5874 μg/mL.
Species

Rat

Source

HEK293

Tag

C-His

Accession

NP_001070261.1 (Q17-N248)

Gene ID
Molecular Construction
N-term
LILRA5 (Q17-N248)
Accession # NP_001070261.1
His
C-term
Synonyms
CD85 antigen-like family member F; ILT-11; LIR-9; CD85f; LILRB7
AA Sequence

QETSGLEGNPHKPTLSVQPGSLVARGKQVTILCEVTTGAQEYRLFKEGGPHPWRTKNTPKATNKAQFLISSIEQQHGGIYRCYYKTPSGWSEHSDPLELVVTGLYSKPSLSIQSSTVVTSGETVTLQCVSQLGFNRFVLTKEGEQKPSLIRDSEFINSTGQFQGLFPMGPVILSQRWMFRCYGYYVNSPQVWSEPSDLLEIHVSEAAQPLGLSPNISHPKTVSQHQDYTMEN

Molecular Weight

Approximately 33-40 kDa due to the glycosylation

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

LILRA5/CD85f Protein, Rat (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LILRA5/CD85f Protein, Rat (HEK293, His)
Cat. No.:
HY-P77063
Quantity:
MCE Japan Authorized Agent: