LILRA5/CD85f Protein, Rat (HEK293, His)
Based on 1 Customer Validation
The LILRA5/CD85f protein is predicted to have inhibitory MHC class I receptor activity and may modulate immune responses. Involved in the MAPK cascade and regulation of cytokine production, expected to be active on the cell surface and extracellular space, and in the plasma membrane. LILRA5/CD85f Protein, Rat (HEK293, His) is the recombinant rat-derived LILRA5/CD85f protein, expressed by HEK293 , with C-His labeled tag.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The LILRA5/CD85f protein is predicted to have inhibitory MHC class I receptor activity and may modulate immune responses. Involved in the MAPK cascade and regulation of cytokine production, expected to be active on the cell surface and extracellular space, and in the plasma membrane. LILRA5/CD85f Protein, Rat (HEK293, His) is the recombinant rat-derived LILRA5/CD85f protein, expressed by HEK293 , with C-His labeled tag.
Background
LILRA5/CD85f Protein is predicted to possess inhibitory MHC class I receptor activity, indicating its potential role in immune modulation. Predicted to participate in processes such as positive regulation of the MAPK cascade, positive regulation of protein tyrosine kinase activity, and the regulation of cytokine production, this protein is expected to be located on the cell surface and in the extracellular space, with predicted activity in the plasma membrane. LILRA5 is orthologous to several human genes, including LILRA5 (leukocyte immunoglobulin-like receptor A5), suggesting evolutionary conservation of its functions. The protein demonstrates biased expression, with significant levels observed in the Spleen (RPKM 160.9), Liver (RPKM 62.0), and seven other tissues, underscoring its potential importance in immune-related processes across various tissues.
Verified Bioactivity
Measured by its binding ability in a functional ELISA. When Recombinant Human LILRA5/CD85f is coated at 2 µg/mL can bind ANGPTL7. The ED50 for this effect is 0.5874 μg/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - ELISA
Bioactivity - ELISA
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag C-His
-
Accession
NP_001070261.1 (Q17-N248)
-
Molecular Construction
-
N-term
-
LILRA5 (Q17-N248)
Accession # NP_001070261.1 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
LILRA5; Leucocyte Ig-Like Receptor A5; Prev. LILRB7; LIR-9; ILT11; Leukocyte Immunoglobulin-Like Receptor, Subfamily B (With TM And ITIM Domains), Member 7; LIR9; Leukocyte Immunoglobulin-Like Receptor Subfamily A Member 5 Soluble; CD85f; Immunoglobulin-L
-
AA Sequence
QETSGLEGNPHKPTLSVQPGSLVARGKQVTILCEVTTGAQEYRLFKEGGPHPWRTKNTPKATNKAQFLISSIEQQHGGIYRCYYKTPSGWSEHSDPLELVVTGLYSKPSLSIQSSTVVTSGETVTLQCVSQLGFNRFVLTKEGEQKPSLIRDSEFINSTGQFQGLFPMGPVILSQRWMFRCYGYYVNSPQVWSEPSDLLEIHVSEAAQPLGLSPNISHPKTVSQHQDYTMEN
-
Molecular Weight
Approximately 34-41 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
