LILRB4/CD85k/ILT3 Protein, Mouse (HEK293, His)
The LILRB4/CD85k/ILT3 protein is a multifaceted inhibitory receptor in immune regulation that significantly downregulates multiple immune responses. As a receptor for FN1 and integrin ITGAV/ITGB3, LILRB4/ILT3 inhibits IgE-mediated mast cell activation, KITLG/SCF-mediated mast cell activation, and antibody production by memory/marginal zone B cells through the ITGAV/ITGB3 interaction. LILRB4/CD85k/ILT3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived LILRB4/CD85k/ILT3 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The LILRB4/CD85k/ILT3 protein is a multifaceted inhibitory receptor in immune regulation that significantly downregulates multiple immune responses. As a receptor for FN1 and integrin ITGAV/ITGB3, LILRB4/ILT3 inhibits IgE-mediated mast cell activation, KITLG/SCF-mediated mast cell activation, and antibody production by memory/marginal zone B cells through the ITGAV/ITGB3 interaction. LILRB4/CD85k/ILT3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived LILRB4/CD85k/ILT3 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
LILRB4/CD85k/ILT3, an inhibitory receptor intricately involved in immune regulation, plays a crucial role in down-regulating immune responses. It serves as a receptor for FN1 and integrin ITGAV/ITGB3, exerting inhibitory effects on IgE-mediated mast cell activation and KITLG/SCF-mediated mast cell activation. Through its interaction with ITGAV/ITGB3, LILRB4/ILT3 further inhibits antibody production by memory and marginal zone B cells, likely by suppressing their differentiation into plasma cells. This multifaceted receptor extends its inhibitory influence to diverse immune functions, such as suppressing IFNG production by CD8 T cells, CD4 T cells, and natural killer cells, as well as inhibiting antigen presentation by dendritic cells to T cells, preventing T cell activation. Additionally, LILRB4/ILT3 effectively inhibits lipopolysaccharide-mediated neutrophil-dependent vascular injury and contributes to the suppression of the allergic inflammatory response by impeding the infiltration of neutrophils and eosinophils while preventing mast cell degranulation. Its interactions, particularly when tyrosine phosphorylated, with SH2 domain-containing phosphatases PTPN6/SHP-1 and PTPN11/SHP-2 enhance the inhibition of mast cell activation.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-6*His
-
Accession
Q64281 (G24-K238)
-
Molecular Construction
-
N-term
-
LILRB4 (G24-K238)
Accession # Q64281 -
6*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
LILRB4; CD85 Antigen-Like Family Member K; Leukocyte Immunoglobulin Like Receptor B4; Monocyte Inhibitory Receptor HM18; LIR-5; Immunoglobulin-Like Transcript 3; ILT3; Leucocyte Ig-Like Receptor B4; LIR5; ILT-3; CD85k; HM18; Leukocyte Immunoglobulin-Like
-
AA Sequence
GHLPKPIIWAEPGSVIAAYTSVITWCQGSWEAQYYHLYKEKSVNPWDTQVPLETRNKAKFNIPSMTTSYAGIYKCYYESAAGFSEHSDAMELVMTGAYENPSLSVYPSSNVTSGVSISFSCSSSIVFGRFILIQEGKHGLSWTLDSQHQANQPSYATFVLDAVTPNHNGTFRCYGYFRNEPQVWSKPSNSLDLMISETKDQSSTPTEDGLETYQK
-
Predicted Molecular Mass
24.9 kDa
-
Molecular Weight
Approximately 33-42 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
