1. Recombinant Proteins
  2. Receptor Proteins
  3. Leukocyte Immunoglobin-like Receptors
  4. Leukocyte Ig-Like Receptor B4
  5. LILRB4/CD85k/ILT3 Protein, Mouse (HEK293, His)

LILRB4/CD85k/ILT3 Protein, Mouse (HEK293, His)

Cat. No.: HY-P72518
Handling Instructions

The LILRB4/CD85k/ILT3 protein is a multifaceted inhibitory receptor in immune regulation that significantly downregulates multiple immune responses. As a receptor for FN1 and integrin ITGAV/ITGB3, LILRB4/ILT3 inhibits IgE-mediated mast cell activation, KITLG/SCF-mediated mast cell activation, and antibody production by memory/marginal zone B cells through the ITGAV/ITGB3 interaction. LILRB4/CD85k/ILT3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived LILRB4/CD85k/ILT3 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of LILRB4/CD85k/ILT3 Protein, Mouse (HEK293, His) is 215 a.a., with molecular weight of 35-40 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The LILRB4/CD85k/ILT3 protein is a multifaceted inhibitory receptor in immune regulation that significantly downregulates multiple immune responses. As a receptor for FN1 and integrin ITGAV/ITGB3, LILRB4/ILT3 inhibits IgE-mediated mast cell activation, KITLG/SCF-mediated mast cell activation, and antibody production by memory/marginal zone B cells through the ITGAV/ITGB3 interaction. LILRB4/CD85k/ILT3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived LILRB4/CD85k/ILT3 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of LILRB4/CD85k/ILT3 Protein, Mouse (HEK293, His) is 215 a.a., with molecular weight of 35-40 kDa.

Background

LILRB4/CD85k/ILT3, an inhibitory receptor intricately involved in immune regulation, plays a crucial role in down-regulating immune responses. It serves as a receptor for FN1 and integrin ITGAV/ITGB3, exerting inhibitory effects on IgE-mediated mast cell activation and KITLG/SCF-mediated mast cell activation. Through its interaction with ITGAV/ITGB3, LILRB4/ILT3 further inhibits antibody production by memory and marginal zone B cells, likely by suppressing their differentiation into plasma cells. This multifaceted receptor extends its inhibitory influence to diverse immune functions, such as suppressing IFNG production by CD8 T cells, CD4 T cells, and natural killer cells, as well as inhibiting antigen presentation by dendritic cells to T cells, preventing T cell activation. Additionally, LILRB4/ILT3 effectively inhibits lipopolysaccharide-mediated neutrophil-dependent vascular injury and contributes to the suppression of the allergic inflammatory response by impeding the infiltration of neutrophils and eosinophils while preventing mast cell degranulation. Its interactions, particularly when tyrosine phosphorylated, with SH2 domain-containing phosphatases PTPN6/SHP-1 and PTPN11/SHP-2 enhance the inhibition of mast cell activation.

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

Q64281 (G24-K238)

Gene ID

14728  [NCBI]

Molecular Construction
N-term
LILRB4 (G24-K238)
Accession # Q64281
6*His
C-term
Synonyms
Leukocyte immunoglobulin-like receptor subfamily B member 4; CD85k; Lilrb4; Gp49b
AA Sequence

GHLPKPIIWAEPGSVIAAYTSVITWCQGSWEAQYYHLYKEKSVNPWDTQVPLETRNKAKFNIPSMTTSYAGIYKCYYESAAGFSEHSDAMELVMTGAYENPSLSVYPSSNVTSGVSISFSCSSSIVFGRFILIQEGKHGLSWTLDSQHQANQPSYATFVLDAVTPNHNGTFRCYGYFRNEPQVWSKPSNSLDLMISETKDQSSTPTEDGLETYQK

Molecular Weight

35-40 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

LILRB4/CD85k/ILT3 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LILRB4/CD85k/ILT3 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P72518
Quantity:
MCE Japan Authorized Agent: