Lipocalin-2/NGAL Protein, Mouse (HEK293, C-His)

Lipocalin-2/NGAL Protein, Mouse (HEK293, His) is an 20-28 kDa NGAL protein with a His-flag, which is expressed in HEK293 cells. NGAL is an antibacterial factor of natural immunity, and an acute-phase protein^[1].

NGAL is a 25 kDa protein belonging to the lipocalin superfamily, which is first known as an antibacterial factor of natural immunity, and an acute-phase protein.
NGAL is initially found in activated neutrophils, and other cells, like kidney tubular cells, may produce NGAL in response to various insults.ipocalin-2 (LCN2/NGAL) has been implicated in a variety of processes including cell differentiation, proliferation, survival, and morphogenesis.NGAL has anti-tumoral and anti-metastatic effects in neoplasias, for example, the colon, ovary and pancreas^[1].

1.Measured by its ability to bind Iron(III) dihydroxybenzoic acid [Fe(DHBA)3] that Incubate at room temperature for 10 minutes. The binding of Fe(DHBA)3 results in the quenching of Trp fluorescence in NGAL. ≤1.852 μM of Fe(DHBA)3 can be bound.
2.Measured by its ability to bind Iron(III) dihydroxybenzoic acid [Fe(DHBA)3] in 30 min at 25℃. The binding of Fe(DHBA)3 results in the quenching of Trp fluorescence in 2μM NGAL. 2.308 μM of Fe(DHBA)3 can be bound.

Mouse

HEK293

C-6*His

P11672 (Q21-N200)

16819  [NCBI]

Full Length of Mature Protein

QDSTQNLIPAPSLLTVPLQPDFRSDQFRGRWYVVGLAGNAVQKKTEGSFTMYSTIYELQENNSYNVTSILVRDQDQGCRYWIRTFVPSSRAGQFTLGNMHRYPQVQSYNVQVATTDYNQFAMVFFRKTSENKQYFKITLYGRTKELSPELKERFTRFAKSLGLKDDNIIFSVPTDQCIDN

Approximately 20-28 kDa due to the glycosylation.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

1.Lyophilized from a 0.22 μm filtered solution of 20 mM MES, 150 mM NaCl, pH 5.5.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
3.Lyophilized from a 0.22 μm filtered solution of 20 mM MES, 150 mM NaCl, pH 5.5, 5% trehalose, 5% mannitol, 0.01% Tween 80.
Please refer to the lot-specific COA for specific buffer information.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.