LIV-1/SLC39A6 Protein, Cynomolgus (Sf9, His)

LIV-1/SLC39A6 is a zinc influx transporter that regulates zinc homeostasis and induces epithelial-mesenchymal transition (EMT). Used in conjunction with SLC39A10, it can promote cellular zinc absorption and trigger EMT. LIV-1/SLC39A6 Protein, Cynomolgus (Sf9, His) is the recombinant cynomolgus-derived LIV-1/SLC39A6 protein, expressed by Sf9 insect cells , with C-His labeled tag. The total length of LIV-1/SLC39A6 Protein, Cynomolgus (Sf9, His) is 289 a.a., with molecular weight of ~45 kDa.

LIV-1/SLC39A6, a zinc-influx transporter, intricately regulates zinc homeostasis and contributes to the induction of epithelial-to-mesenchymal transition (EMT). Functionally, when forming a heterodimer with SLC39A10, this complex mediates cellular zinc uptake, serving as a pivotal trigger for EMT. The SLC39A10-SLC39A6 heterodimer not only controls NCAM1 phosphorylation but also influences its integration into focal adhesion complexes during EMT. The zinc influx facilitated by this heterodimeric complex plays a crucial role in inactivating GSK3B, leading to nuclear accumulation of unphosphorylated SNAI1, which subsequently down-regulates adherence genes like CDH1, thereby promoting loss of cell adherence. Beyond its involvement in EMT, the SLC39A10-SLC39A6 heterodimer plays a fundamental role in initiating mitosis by importing zinc into cells, triggering a pathway that culminates in the onset of mitosis. Additionally, this transporter complex contributes to T-cell receptor signaling regulation and facilitates proper zinc influx for meiotic progression during the oocyte-to-egg transition.

Immobilized Cynomolgus LIV-1 His at 2 μg/mL (100 μL/well) can bind Anti-LIV-1 Antibody Human IgG1 with a linear range of ≤3 ng/mL.

Cynomolgus

Sf9 insect cells

C-His

XP_005586923 (L21-I309)

101926643  [NCBI]

LHELKSAAAFPQTTEKISPNWESGINVDLAITTRQYHLQQLFYRYGENNSLSVEGFRKLLQNIGIDKIKRIHIHHDHDHHSDHEHHSDHEHHSDHEHHSHRNHAASGKNKRKALCPEHDSDSSGKDPRNSQGKGAHRPEHANGRRNVKDSVSTSEVTSTVYNTVSEGTHFLETIETPKLFPKDVSSSTPPSVTEKSLVSRLAGRKTNESMSEPRKGFMYSRNTNENPQECFNASKLLTSHGMGIQVPLNATEFNYLCPAIINQIDARSCLIHTSEKKAEIPPKTYSLQI

Approximately 45 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized a 0.22 μm filtered solution ofPBS, 6% Trehalose, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.