LolA Protein, E.coli (P.pastoris, His)
LolA Protein translocates lipoproteins from bacterial inner to outer membranes, forming a complex dependent on the absence of aspartate after the N-terminal cysteine. Aspartate signals lipoproteins to stay in the inner membrane. LolA, as a monomer, efficiently moves lipoproteins between bacterial membrane compartments. LolA Protein, E.coli (P.pastoris, His) is the recombinant E. coli-derived LolA protein, expressed by P. pastoris , with N-His labeled tag.
- Species: E.coli
- Source: P. pastoris
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
LolA Protein translocates lipoproteins from bacterial inner to outer membranes, forming a complex dependent on the absence of aspartate after the N-terminal cysteine. Aspartate signals lipoproteins to stay in the inner membrane. LolA, as a monomer, efficiently moves lipoproteins between bacterial membrane compartments. LolA Protein, E.coli (P.pastoris, His) is the recombinant E. coli-derived LolA protein, expressed by P. pastoris , with N-His labeled tag.
Background
LolA Protein is involved in the translocation of lipoproteins from the inner membrane to the outer membrane in bacterial cells. It forms a complex with lipoproteins, but this interaction is contingent upon the absence of aspartate immediately following the N-terminal cysteine in the lipoprotein sequence. The presence of aspartate serves as a targeting signal, indicating that the lipoprotein should remain in the inner membrane. LolA functions as a monomer in facilitating the efficient movement of lipoproteins between bacterial membrane compartments.
Technical Parameters
-
Species E.coli
-
Source P. pastoris
-
Tag N-His
-
Accession
A7ZYJ5 (D22-K203)
-
Gene ID/
-
Molecular Construction
-
N-term
-
His
-
LolA (D22-K203)
Accession # A7ZYJ5 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
Outer-membrane lipoprotein carrier protein; lolA; EcHS_A0996
-
AA Sequence
DAASDLKSRLDKVSSFHASFTQKVTDGSGAAVQEGQGDLWVKRPNLFNWHMTQPDESILVSDGKTLWFYNPFVEQATATWLKDATGNTPFMLIARNQSSDWQQYNIKQNGDDFVLTPKASNGNLKQFTINVGRDGTIHQFSAVEQDDQRSSYQLKSQQNGAVDAAKFTFTPPQGVTVDDQRK
-
Predicted Molecular Mass
22.3 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
