1. Recombinant Proteins
  2. Enzymes & Regulators
  3. LPAL2 Protein, Human (HEK293, Fc)

LPAL2 Protein, Human (HEK293, Fc)

Cat. No.: HY-P77066
COA Handling Instructions

LPAL2 is a pseudogene and modulates tumor growth, metastasis and stemness phenotypes of HCC. LPAL2 is a biomarker in malignant cholangiocytes. LPAL2/miR-1287-5p axis modulates TGF-β1–induced increases in cell adhesion factor levels and thyroid eye disease (TED) orbital fibroblast activation through EGFR/AKT signaling. LPAL2 Protein, Human (HEK293, Fc) is the recombinant human-derived LPAL2 protein, expressed by HEK293 , with C-mFc labeled tag. The total length of LPAL2 Protein, Human (HEK293, Fc) is 111 a.a., with molecular weight of ~48.2 & 42.7 kDa, respectively.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $40 In-stock
10 μg $70 In-stock
50 μg $200 In-stock
100 μg $340 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

LPAL2 is a pseudogene and modulates tumor growth, metastasis and stemness phenotypes of HCC. LPAL2 is a biomarker in malignant cholangiocytes. LPAL2/miR-1287-5p axis modulates TGF-β1–induced increases in cell adhesion factor levels and thyroid eye disease (TED) orbital fibroblast activation through EGFR/AKT signaling. LPAL2 Protein, Human (HEK293, Fc) is the recombinant human-derived LPAL2 protein, expressed by HEK293 , with C-mFc labeled tag. The total length of LPAL2 Protein, Human (HEK293, Fc) is 111 a.a., with molecular weight of ~48.2 & 42.7 kDa, respectively.

Background

LPAL2 is a Pseudogene. LPAL2 Protein modulates tumor growth, metastasis and stemness phenotypes of HCC cell lines by modulating MMP9 expression. LPAL2 is a tumor-suppressor lncRNA in HCC[1]. Besides, LPAL2 is also associated with thyroid eye disease. Specifically, LPAL2/miR-1287-5p axis modulates TGF-β1–induced increases in cell adhesion factor levels and thyroid eye disease (TED) orbital fibroblast activation through EGFR/AKT signaling. In TED orbital tissues, expression of the lncRNA LPAL2 is upregulated and positively correlated with ICAM-1 and ICAM-4 expression. LPAL2 directly targets miR-1287-5p to inhibit its expression[2]. LPAL2 is also a biomarker in malignant cholangiocytes[3].

Biological Activity

Measured by its ability to inhibit the proliferation of Huh-7 cells. The ED50 for this effect is 4.719 μg/mL, corresponding to a specific activity is 2.119×103 units/mg.

  • Measured by its ability to inhibit the proliferation of Huh-7 cells. The ED50 for this effect is 4.719 μg/mL , corresponding to a specific activity is 2.119×103 units/mg.
Species

Human

Source

HEK293

Tag

C-mFc

Accession

Q16609 (G22-A132)

Gene ID

80350  [NCBI]

Molecular Construction
N-term
LPAL2 (G22-A132)
Accession # Q16609
mFc
C-term
Synonyms
Putative apolipoprotein(a)-like protein 2; Apo(a)-like protein 2; APOARGC
AA Sequence

GPSVQECYHSNGQSYRGTYFTTVTGRTCQAWSSMTPHQHSRTPEKYPNDGLISNYCRNPDCSAGPWCYTTDPNVRWEYCNLTRCSDDEGTVFVPLTVIPVPSLEDSFIQVA

Molecular Weight

Approximately 41-44 kDa due to the glycosylation

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

LPAL2 Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LPAL2 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P77066
Quantity:
MCE Japan Authorized Agent: