LRRC3B Protein, Human (HEK293, His)
LRRC3B Protein is a leucine-rich repeat-containing transmembrane protein. LRRC3B, a tumor suppressor, is invovled in carcinogenesis, and the expression is down-regulated in gastric, breast, colon, testis, prostate, and brain cancers. But LRRC3B is up-regulated in the virus infected group. LRRC3B is involved in plant and animal immunity, hormone-receptor interactions, cell adhesion, signal transduction, regulation of gene expression, and apoptosis. LRRC3B Protein, Human (HEK293, His) is the recombinant human-derived LRRC3B protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
LRRC3B Protein is a leucine-rich repeat-containing transmembrane protein. LRRC3B, a tumor suppressor, is invovled in carcinogenesis, and the expression is down-regulated in gastric, breast, colon, testis, prostate, and brain cancers. But LRRC3B is up-regulated in the virus infected group. LRRC3B is involved in plant and animal immunity, hormone-receptor interactions, cell adhesion, signal transduction, regulation of gene expression, and apoptosis[1][2][3]. LRRC3B Protein, Human (HEK293, His) is the recombinant human-derived LRRC3B protein, expressed by HEK293 , with C-6*His labeled tag.
Background
Leucine-rich repeat-containing protein 3B (LRRC3B) is a leucine-rich repeat-containing transmembrane protein. LRRC3B, a tumor suppressor, is invovled in carcinogenesis, and the expression is down-regulated in gastric, breast, colon, testis, prostate, and brain cancers[1]. LRRC3B is involved in plant and animal immunity, hormone-receptor interactions, cell adhesion, signal transduction, regulation of gene expression, and apoptosis[2]. Besides, It's reported that LRRC3B is up-regulated in the virus infected group compared with the control, indicating LRRC3B is involved in immune-related processes that trigger the innate immune response through activation of the IFN signaling pathway[3].
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
Q96PB8 (C34-Y204)
-
Molecular Construction
-
N-term
-
LRRC3B (C34-Y204)
Accession # Q96PB8 -
6*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
LRRC3B; Leucine-Rich Repeat-Containing Protein 3B; Leucine Rich Repeat Containing 3B; Leucine-Rich Repeat Protein 15; LRP15; Leucine-Rich Repeat Protein LRP15
-
AA Sequence
CPKGCLCSSSGGLNVTCSNANLKEIPRDLPPETVLLYLDSNQITSIPNEIFKDLHQLRVLNLSKNGIEFIDEHAFKGVAETLQTLDLSDNRIQSVHKNAFNNLKARARIANNPWHCDCTLQQVLRSMASNHETAHNVICKTSVLDEHAGRPFLNAANDADLCNLPKKTTDY
-
Predicted Molecular Mass
20 kDa
-
Molecular Weight
Approximately 20-29 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
