LSP1 Protein, Human (HEK293, His)

The LSP1 protein may play an important role in mediating neutrophil activation and chemotaxis, suggesting its involvement in immune responses. LSP1 is known to bind actin and may influence cytoskeletal dynamics critical for cell migration. LSP1 Protein, Human (HEK293, His) is the recombinant human-derived LSP1 protein, expressed by HEK293 , with C-His labeled tag. The total length of LSP1 Protein, Human (HEK293, His) is 339 a.a., with molecular weight of ~38.7 kDa.

The LSP1 protein is implicated in potentially playing a significant role in mediating neutrophil activation and chemotaxis, underscoring its involvement in the complex processes associated with the immune response. Functionally, LSP1 is known to bind actin, suggesting its participation in the cytoskeletal dynamics that are integral to cellular migration and chemotactic responses. The precise mechanisms by which LSP1 modulates neutrophil activation, chemotaxis, and its interactions with actin remain areas of interest, warranting further investigation to unravel its specific functions and molecular contributions in the intricate orchestration of immune cell responses.

Human

HEK293

C-6*His

P33241-1 (M1-P339)

4046  [NCBI]

MAEASSDPGAEEREELLGPTAQWSVEDEEEAVHEQCQHERDRQLQAQDEEGGGHVPERPKQEMLLSLKPSEAPELDEDEGFGDWSQRPEQRQQHEGAQGALDSGEPPQCRSPEGEQEDRPGLHAYEKEDSDEVHLEELSLSKEGPGPEDTVQDNLGAAGAEEEQEEHQKCQQPRTPSPLVLEGTIEQSSPPLSPTTKLIDRTESLNRSIEKSNSVKKSQPDLPISKIDQWLEQYTQAIETAGRTPKLARQASIELPSMAVASTKSRWETGEVQAQSAAKTPSCKDIVAGDMSKKSLWEQKGGSKTSSTIKSTPSGKRYKFVATGHGKYEKVLVEGGPAP

Approximately 60 kDa due to the glycosylation

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.