Copy Link Print Information

LUXS Protein, E.coli (His)

Customer Review

Based on 1 Customer Validation

LUXS proteins are critical for the synthesis of bacterially secreted autoinducer 2 (AI-2), which promotes communication between cell density and environmental metabolism. LUXS is critical for quorum sensing and catalyzes S-ribosylhomocysteine (RHC) to homocysteine (HC) and 4,5-dihydroxy-2,3-pentanedione (DPD) , revealing its enzymatic role in AI-2 production. LUXS Protein, E.coli (His) is the recombinant E. coli-derived LUXS protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: E.coli
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for LUXS Protein, E.coli (His)
  • LUXS Protein, E.coli (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

LUXS proteins are critical for the synthesis of bacterially secreted autoinducer 2 (AI-2), which promotes communication between cell density and environmental metabolism. LUXS is critical for quorum sensing and catalyzes S-ribosylhomocysteine (RHC) to homocysteine (HC) and 4,5-dihydroxy-2,3-pentanedione (DPD) , revealing its enzymatic role in AI-2 production. LUXS Protein, E.coli (His) is the recombinant E. coli-derived LUXS protein, expressed by E. coli , with N-6*His labeled tag.

Background

The LUXS Protein plays a pivotal role in the synthesis of autoinducer 2 (AI-2), a signaling molecule secreted by bacteria that facilitates communication regarding both cell density and the metabolic potential of the environment. This process is integral to quorum sensing, the regulation of gene expression in response to changes in cell density. LUXS catalyzes the transformation of S-ribosylhomocysteine (RHC) into homocysteine (HC) and 4,5-dihydroxy-2,3-pentadione (DPD), elucidating its enzymatic involvement in the production of AI-2. The intricate functions of LUXS highlight its crucial role in bacterial communication and sensing mechanisms, contributing to the coordination of bacterial behavior in response to environmental cues.

Technical Parameters

  • Species E.coli
  • Source E. coli
  • Tag N-6*His
  • Accession

    P45578 (P2-I171)

  • Gene ID
    947168  [NCBI]
  • Molecular Construction
    • N-term
    • 6*His
    • LUXS (P2-I171)
      Accession # P45578
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    luxS; ygaG; b2687; JW2662; S-ribosylhomocysteine lyase; EC 4.4.1.21; AI-2 synthesis protein; Autoinducer-2 production protein LuxS

  • AA Sequence

    PLLDSFTVDHTRMEAPAVRVAKTMNTPHGDAITVFDLRFCVPNKEVMPERGIHTLEHLFAGFMRNHLNGNGVEIIDISPMGCRTGFYMSLIGTPDEQRVADAWKAAMEDVLKVQDQNQIPELNVYQCGTYQMHSLQEAQDIARSILERDVRINSNEELALPKEKLQELHI

  • Molecular Weight

    Approximately 23-25 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

    • Experimental Validation Results for LUXS Protein, E.coli (His)
      ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

  • ≥ 95%, as determined by reducing SDS-PAGE.
Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • LUXS Protein, E.coli (His) Product Image
    1/16
  • Experimental Validation Results for LUXS Protein, E.coli (His)
  • LUXS Protein, E.coli (His) Product Image