LUXS Protein, E.coli (His)

LUXS proteins are critical for the synthesis of bacterially secreted autoinducer 2 (AI-2), which promotes communication between cell density and environmental metabolism. LUXS is critical for quorum sensing and catalyzes S-ribosylhomocysteine (RHC) to homocysteine (HC) and 4,5-dihydroxy-2,3-pentanedione (DPD) , revealing its enzymatic role in AI-2 production. LUXS Protein, E.coli (His) is the recombinant E. coli-derived LUXS protein, expressed by E. coli , with N-6*His labeled tag. The total length of LUXS Protein, E.coli (His) is 170 a.a., with molecular weight of 23-25 kDa.

The LUXS Protein plays a pivotal role in the synthesis of autoinducer 2 (AI-2), a signaling molecule secreted by bacteria that facilitates communication regarding both cell density and the metabolic potential of the environment. This process is integral to quorum sensing, the regulation of gene expression in response to changes in cell density. LUXS catalyzes the transformation of S-ribosylhomocysteine (RHC) into homocysteine (HC) and 4,5-dihydroxy-2,3-pentadione (DPD), elucidating its enzymatic involvement in the production of AI-2. The intricate functions of LUXS highlight its crucial role in bacterial communication and sensing mechanisms, contributing to the coordination of bacterial behavior in response to environmental cues.

Data is not available.

E.coli

E. coli

N-6*His

P45578 (P2-I171)

58460147  [NCBI]

PLLDSFTVDHTRMEAPAVRVAKTMNTPHGDAITVFDLRFCVPNKEVMPERGIHTLEHLFAGFMRNHLNGNGVEIIDISPMGCRTGFYMSLIGTPDEQRVADAWKAAMEDVLKVQDQNQIPELNVYQCGTYQMHSLQEAQDIARSILERDVRINSNEELALPKEKLQELHI

23-25 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against solution in PBS, 6% Trehalose, pH 7.4 or PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.