LUXS Protein, E.coli (His)

Customer Review

Based on 1 Customer Validation

LUXS proteins are critical for the synthesis of bacterially secreted autoinducer 2 (AI-2), which promotes communication between cell density and environmental metabolism. LUXS is critical for quorum sensing and catalyzes S-ribosylhomocysteine (RHC) to homocysteine (HC) and 4,5-dihydroxy-2,3-pentanedione (DPD) , revealing its enzymatic role in AI-2 production. LUXS Protein, E.coli (His) is the recombinant E. coli-derived LUXS protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: E.coli
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

LUXS proteins are critical for the synthesis of bacterially secreted autoinducer 2 (AI-2), which promotes communication between cell density and environmental metabolism. LUXS is critical for quorum sensing and catalyzes S-ribosylhomocysteine (RHC) to homocysteine (HC) and 4,5-dihydroxy-2,3-pentanedione (DPD) , revealing its enzymatic role in AI-2 production. LUXS Protein, E.coli (His) is the recombinant E. coli-derived LUXS protein, expressed by E. coli , with N-6*His labeled tag.

Background

The LUXS Protein plays a pivotal role in the synthesis of autoinducer 2 (AI-2), a signaling molecule secreted by bacteria that facilitates communication regarding both cell density and the metabolic potential of the environment. This process is integral to quorum sensing, the regulation of gene expression in response to changes in cell density. LUXS catalyzes the transformation of S-ribosylhomocysteine (RHC) into homocysteine (HC) and 4,5-dihydroxy-2,3-pentadione (DPD), elucidating its enzymatic involvement in the production of AI-2. The intricate functions of LUXS highlight its crucial role in bacterial communication and sensing mechanisms, contributing to the coordination of bacterial behavior in response to environmental cues.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species E.coli
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • LUXS (P2-I171)
      Accession # P45578
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    luxS; ygaG; b2687; JW2662; S-ribosylhomocysteine lyase; EC 4.4.1.21; AI-2 synthesis protein; Autoinducer-2 production protein LuxS

  • AA Sequence

    PLLDSFTVDHTRMEAPAVRVAKTMNTPHGDAITVFDLRFCVPNKEVMPERGIHTLEHLFAGFMRNHLNGNGVEIIDISPMGCRTGFYMSLIGTPDEQRVADAWKAAMEDVLKVQDQNQIPELNVYQCGTYQMHSLQEAQDIARSILERDVRINSNEELALPKEKLQELHI

  • Molecular Weight

    Approximately 23-25 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00