Lymphocyte antigen 6C1/LY6C1 Protein, Mouse (P.pastoris, His)
Lymphocyte antigen 6C1 enables acetylcholine receptor binding activity and acetylcholine receptor inhibitor activity.Lymphocyte antigen 6C1 is involved in acetylcholine receptor signaling pathway.Lymphocyte antigen 6C1/LY6C1 Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Lymphocyte antigen 6C1/LY6C1 protein, expressed by P.pastoris , with N-6*His labeled tag.
- Species: Mouse
- Source: P. pastoris
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Lymphocyte antigen 6C1 enables acetylcholine receptor binding activity and acetylcholine receptor inhibitor activity.Lymphocyte antigen 6C1 is involved in acetylcholine receptor signaling pathway.Lymphocyte antigen 6C1/LY6C1 Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Lymphocyte antigen 6C1/LY6C1 protein, expressed by P.pastoris , with N-6*His labeled tag.
Background
Lymphocyte antigen 6C1 enables acetylcholine receptor binding activity and acetylcholine receptor inhibitor activity. Lymphocyte antigen 6C1 is involved in acetylcholine receptor signaling pathway. Lymphocyte antigen 6C1 located in external side of plasma membrane. Lymphocyte antigen 6C1 is expressed in embryo mesenchyme, gut, liver, metanephros and nasal cavity[1][2][3].
Technical Parameters
-
Species Mouse
-
Source P. pastoris
-
Tag N-6*His
-
Accession
P0CW02 (L27-G109)
-
Gene ID17067 [NCBI]
-
Molecular Construction
-
N-term
-
6*His
-
Ly6c1 (L27-G109)
Accession # P0CW02 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
Lymphocyte antigen 6C1; Ly-6C1; Ly6c1
-
AA Sequence
LQCYECYGVPIETSCPAVTCRASDGFCIAQNIELIEDSQRRKLKTRQCLSFCPAGVPIRDPNIRERTSCCSEDLCNAAVPTAG
-
Predicted Molecular Mass
25.1 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
