2. Recombinant Proteins
  3. Others
  4. Lymphocyte antigen 6C1/LY6C1 Protein, Mouse (P.pastoris, His)

Lymphocyte antigen 6C1/LY6C1 Protein, Mouse (P.pastoris, His)

Cat. No.: HY-P71796
Handling Instructions

Lymphocyte antigen 6C1 enables acetylcholine receptor binding activity and acetylcholine receptor inhibitor activity. Lymphocyte antigen 6C1 is involved in acetylcholine receptor signaling pathway. Lymphocyte antigen 6C1/LY6C1 Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Lymphocyte antigen 6C1/LY6C1 protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of Lymphocyte antigen 6C1/LY6C1 Protein, Mouse (P.pastoris, His) is 83 a.a., with molecular weight of ~25.1 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Lymphocyte antigen 6C1 enables acetylcholine receptor binding activity and acetylcholine receptor inhibitor activity. Lymphocyte antigen 6C1 is involved in acetylcholine receptor signaling pathway. Lymphocyte antigen 6C1/LY6C1 Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Lymphocyte antigen 6C1/LY6C1 protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of Lymphocyte antigen 6C1/LY6C1 Protein, Mouse (P.pastoris, His) is 83 a.a., with molecular weight of ~25.1 kDa.
Background

Lymphocyte antigen 6C1 enables acetylcholine receptor binding activity and acetylcholine receptor inhibitor activity. Lymphocyte antigen 6C1 is involved in acetylcholine receptor signaling pathway. Lymphocyte antigen 6C1 located in external side of plasma membrane. Lymphocyte antigen 6C1 is expressed in embryo mesenchyme, gut, liver, metanephros and nasal cavity[1][2][3].
Species

Mouse
Source

P. pastoris
Tag

N-6*His
Accession

P0CW02 (27L-109G)
Gene ID

17067  [NCBI]
Molecular Construction
N-term
6*His
Ly6c1 (27L-109G)
Accession # P0CW02
C-term
Synonyms
Ly6c1; Lymphocyte antigen 6C1; Ly-6C1
AA Sequence

LQCYECYGVPIETSCPAVTCRASDGFCIAQNIELIEDSQRRKLKTRQCLSFCPAGVPIRDPNIRERTSCCSEDLCNAAVPTAG

Molecular Weight

Approximately 25.1 kDa
Purity

Greater than 90% as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)

Lymphocyte antigen 6C1/LY6C1 Protein, Mouse (P.pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Lymphocyte antigen 6C1/LY6C1 Protein, Mouse (P.pastoris, His)
Cat. No.:
HY-P71796
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.