Lymphocyte antigen 6G/LY6G Protein, Mouse (P.pastoris)

Lymphocyte antigen 6G/LY6G protein is uniquely expressed in bone marrow, indicating its involvement in the hematopoietic microenvironment. This suggests a role in regulating immune cell development or function within the bone marrow niche. Lymphocyte antigen 6G/LY6G Protein, Mouse (P.pastoris) is the recombinant mouse-derived Lymphocyte antigen 6G/LY6G protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of Lymphocyte antigen 6G/LY6G Protein, Mouse (P.pastoris) is 93 a.a., with molecular weight (glycosylation form) of ~34 kDa.

Lymphocyte antigen 6G/LY6G protein is specifically expressed in the bone marrow. This localization underscores its involvement in the hematopoietic microenvironment and suggests a potential role in regulating immune cell development or function within the bone marrow niche. The restricted expression pattern of LY6G to this particular tissue implies its specificity in contributing to hematopoietic processes, reflecting its significance in the context of immune cell homeostasis or response mechanisms within the bone marrow microenvironment.

Mouse

P. pastoris

N-6*His

P35461 (L27-G119)

546644  [NCBI]

LECYNCIGVPPETSCNTTTCPFSDGFCVALEIEVIVDSHRSKVKSNLCLPICPTTLDNTEITGNAVNVKTYCCKEDLCNAAVPTGGSSWTMAG

Approximately 34 kDa.The reducing (R) protein migrat es as 34 kDa in SDS-PAGE may be due to glycosylation.

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.