Major urinary protein 11 Protein, Mouse (His)
Major urinary protein 11 Protein functions as a key player in pheromone binding, stabilizing and facilitating their slow release from urine marks. It may safeguard pheromones from oxidation and potentially acts as a pheromone itself, influencing social behaviors like aggression, mating, pup-suckling, territory establishment, and dominance. The protein exhibits in vitro binding to the pheromone analog 2-sec-butyl-4,5-dihydrothiazole (SBT). Major urinary protein 11 Protein, Mouse (His) is the recombinant mouse-derived Major urinary protein 11 protein, expressed by E. coli , with N-His labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Major urinary protein 11 Protein functions as a key player in pheromone binding, stabilizing and facilitating their slow release from urine marks. It may safeguard pheromones from oxidation and potentially acts as a pheromone itself, influencing social behaviors like aggression, mating, pup-suckling, territory establishment, and dominance. The protein exhibits in vitro binding to the pheromone analog 2-sec-butyl-4,5-dihydrothiazole (SBT). Major urinary protein 11 Protein, Mouse (His) is the recombinant mouse-derived Major urinary protein 11 protein, expressed by E. coli , with N-His labeled tag.
Background
Major urinary protein 11 Protein, a member of the Major urinary proteins (Mups) family, plays a crucial role in binding pheromones, stabilizing them for slow release into the air through urine marks. This function may protect pheromones from oxidation and, intriguingly, Mups themselves may act as pheromones. In the context of social behaviors, including aggression, mating, pup-suckling, territory establishment, and dominance, Major urinary protein 11 is presumed to contribute to the regulation of these behaviors. Additionally, in vitro studies indicate its ability to bind the pheromone analog 2-sec-butyl-4,5-dihydrothiazole (SBT).
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-His
-
Accession
P04938 (E32-E181)
-
Gene ID100039028 [NCBI]
-
Molecular Construction
-
N-term
-
His
-
Mup11 (E32-E181)
Accession # P04938 -
C-term
-
-
Protein Length
Partial
-
Synonyms
Major urinary protein 11; Mup11; Mup9
-
AA Sequence
EKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRCLQARE
-
Predicted Molecular Mass
23.6 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
