Major urinary protein 11 Protein, Mouse (His)

Major urinary protein 11 Protein functions as a key player in pheromone binding, stabilizing and facilitating their slow release from urine marks. It may safeguard pheromones from oxidation and potentially acts as a pheromone itself, influencing social behaviors like aggression, mating, pup-suckling, territory establishment, and dominance. The protein exhibits in vitro binding to the pheromone analog 2-sec-butyl-4,5-dihydrothiazole (SBT). Major urinary protein 11 Protein, Mouse (His) is the recombinant mouse-derived Major urinary protein 11 protein, expressed by E. coli , with N-His labeled tag. The total length of Major urinary protein 11 Protein, Mouse (His) is 151 a.a., with molecular weight of ~23.6 kDa.

Major urinary protein 11 Protein, a member of the Major urinary proteins (Mups) family, plays a crucial role in binding pheromones, stabilizing them for slow release into the air through urine marks. This function may protect pheromones from oxidation and, intriguingly, Mups themselves may act as pheromones. In the context of social behaviors, including aggression, mating, pup-suckling, territory establishment, and dominance, Major urinary protein 11 is presumed to contribute to the regulation of these behaviors. Additionally, in vitro studies indicate its ability to bind the pheromone analog 2-sec-butyl-4,5-dihydrothiazole (SBT).

Mouse

E. coli

N-His

P04938 (1R-151E)

100039028  [NCBI]

REKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRCLQARE

Approximately 23.6 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.