Matrix protein 2 Protein, Influenza A virus 1934 H1N1 (Cell-Free, His)

Matrix protein 2 (M2) is at the core, forming a proton-selective ion channel that is critical for efficient release of the viral genome during entry. After attaching to the cell surface, virions undergo endocytosis and activate M2 ion channels in endosomes. Matrix protein 2 Protein, Influenza A virus 1934 H1N1 (Cell-Free, His) is the recombinant Virus-derived Matrix protein 2 protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of Matrix protein 2 Protein, Influenza A virus 1934 H1N1 (Cell-Free, His) is 97 a.a., with molecular weight of 12.5 kDa.

Matrix protein 2 (M2) plays a pivotal role as it forms a proton-selective ion channel necessary for the efficient release of the viral genome during virus entry. Upon attachment to the cell surface, the virion undergoes endocytosis, and the acidification of the endosome activates M2 ion channel activity. Proton influx disrupts interactions between viral ribonucleoprotein (RNP), matrix protein 1 (M1), and lipid bilayers, freeing the viral genome for migration to the host cell nucleus. Additionally, M2 is involved in the viral protein secretory pathway, elevating intravesicular pH in acidic compartments like the trans-Golgi network, preventing premature fusion-active conformation of newly formed hemagglutinin. Notably, the M2 protein in most influenza A strains is inhibited by amantadine and rimantadine, leading to viral uncoating incapacity, although the emergence of amantadine-resistant variants is typically rapid.

Virus

E. coli Cell-free

N-10*His

P06821 (M1-E97)

956528

MSLLTEVETPIRNEWGCRCNGSSDPLAIAANIIGILHLILWILDRLFFKCIYRRFKYGLKGGPSTEGVPKSMREEYRKEQQSAVDADDGHFVSIELE

12.5 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.