Matrix protein 2 Protein, Influenza A virus 1935 H1N1 (Cell-Free, His)

Matrix protein 2 (M2) forms a proton-selective ion channel that is critical for the release of the viral genome during viral entry. Matrix protein 2 Protein, Influenza A virus 1935 H1N1 (Cell-Free, His) is the recombinant Virus-derived Matrix protein 2 protein, expressed by E. coli Cell-free , with N-6*His labeled tag. The total length of Matrix protein 2 Protein, Influenza A virus 1935 H1N1 (Cell-Free, His) is 97 a.a., with molecular weight of 15.1 kDa.

Matrix protein 2 (M2) forms a proton-selective ion channel crucial for efficient viral genome release during virus entry. After attaching to the cell surface, the virion undergoes endocytosis, and acidification of the endosome activates M2 ion channel. Proton influx disrupts interactions among viral ribonucleoprotein (RNP), matrix protein 1 (M1), and lipid bilayers, freeing the viral genome. M2 also modulates the secretory pathway of viral proteins and elevates intravesicular pH, preventing premature fusion-active conformation of hemagglutinin. Influenza A strains' M2 is inhibited by amantadine and rimantadine, though rapid emergence of amantadine-resistant variants is common.

Virus

E. coli Cell-free

N-6*His

A4GCM0 (M1-E97)

/

MSLLTEVETPIRNEWGCRCNGSSDPLVIAASIIGILHLILWILDRLLFKCIYRRFKYGLKRGPSTEGVPESMREEYRKEQQSAVDADDGHFVNIEPE

15.1 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.