1. Recombinant Proteins
  2. Viral Proteins
  3. Influenza Viruses Proteins
  4. Matrix protein 2 Protein, Influenza A virus 1935 H1N1 (Cell-Free, His)

Matrix protein 2 Protein, Influenza A virus 1935 H1N1 (Cell-Free, His)

Art. -Nr.: HY-P702369
Handling Instructions Technical Support

Matrix protein 2 (M2) forms a proton-selective ion channel that is critical for the release of the viral genome during viral entry. Matrix protein 2 Protein, Influenza A virus 1935 H1N1 (Cell-Free, His) is the recombinant Virus-derived Matrix protein 2 protein, expressed by E. coli Cell-free , with N-6*His labeled tag.

Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Größe Preis Verfügbarkeit Menge
100 μg Auf Lager
> 100 μg   Angebot einholen  

* Bitte wählen Sie Menge, bevor Sie Artikel hinzufügen.

Top Publications Citing Use of Products
  • Biologische Aktivität

  • Technical Parameters

  • Properties

  • Beschreibung

Beschreibung

Matrix protein 2 (M2) forms a proton-selective ion channel that is critical for the release of the viral genome during viral entry. Matrix protein 2 Protein, Influenza A virus 1935 H1N1 (Cell-Free, His) is the recombinant Virus-derived Matrix protein 2 protein, expressed by E. coli Cell-free , with N-6*His labeled tag.

Background

Matrix protein 2 (M2) forms a proton-selective ion channel crucial for efficient viral genome release during virus entry. After attaching to the cell surface, the virion undergoes endocytosis, and acidification of the endosome activates M2 ion channel. Proton influx disrupts interactions among viral ribonucleoprotein (RNP), matrix protein 1 (M1), and lipid bilayers, freeing the viral genome. M2 also modulates the secretory pathway of viral proteins and elevates intravesicular pH, preventing premature fusion-active conformation of hemagglutinin. Influenza A strains' M2 is inhibited by amantadine and rimantadine, though rapid emergence of amantadine-resistant variants is common.

Species

Virus

Source

E. coli Cell-free

Tag

N-6*His

Accession

A4GCM0 (M1-E97)

Gene ID

/

Molecular Construction
N-term
6*His
Matrix 2 (M1-E97)
Accession # A4GCM0
C-term
Protein Length

Full Length

Synonyms
Matrix protein 2; Proton channel protein M2
AA Sequence

MSLLTEVETPIRNEWGCRCNGSSDPLVIAASIIGILHLILWILDRLLFKCIYRRFKYGLKRGPSTEGVPESMREEYRKEQQSAVDADDGHFVNIEPE

Predicted Molecular Mass
15.1 kDa
Molekulargewicht

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Reinheit

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 0.05% Brij78, 6% trehalose, pH 7.4.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add 5-50% of glycerol (final concentration). Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Versand

Room temperature in continental US; may vary elsewhere.

Dokumentation

Matrix protein 2 Protein, Influenza A virus 1935 H1N1 (Cell-Free, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Ihre kürzlich angesehenen Produkte:

Online-Anfrage

Your information is safe with us. * Required Fields.

Matrix protein 2 Protein, Influenza A virus 1935 H1N1 (Cell-Free, His)

 

Requested Quantity *

Name des Antragstellers *

 

Anrede

E-Mail-Addresse *

 

Telefonnummer *

Department

 

Name der Organisation *

City

Bundesland

Country or Region *

     

Bemerkungen

Massenanfrage

Inquiry Information

Produktname:
Matrix protein 2 Protein, Influenza A virus 1935 H1N1 (Cell-Free, His)
Art. -Nr.:
HY-P702369
Menge:
MCE Japan Authorized Agent: