Matrix protein 2 Protein, Influenza A virus (Cell-Free, His, Myc)

Matrix protein 2 (M2) forms a proton-selective ion channel that efficiently releases the viral genome during viral entry. Matrix protein 2 Protein, Influenza A virus (Cell-Free, His, Myc) is the recombinant Virus-derived Matrix protein 2 protein, expressed by E. coli Cell-free , with N-10*His, C-Myc labeled tag. The total length of Matrix protein 2 Protein, Influenza A virus (Cell-Free, His, Myc) is 97 a.a., with molecular weight of 18.6 kDa.

Matrix protein 2 (M2) plays a pivotal role in the influenza virus life cycle, as it forms a proton-selective ion channel crucial for efficient viral genome release during virus entry. Following virion attachment to the cell surface, endocytosis is initiated, and the acidification of the endosome activates the M2 ion channel. This channel facilitates the influx of protons into the virion interior, disrupting interactions among the viral ribonucleoprotein (RNP), matrix protein 1 (M1), and lipid bilayers. This disruption is instrumental in freeing the viral genome from interactions with viral proteins, enabling RNA segments to migrate to the host cell nucleus, where influenza virus RNA transcription and replication occur. Additionally, M2 plays a role in the secretory pathway of viral proteins by modulating intravesicular pH in acidic compartments, such as the trans-Golgi network. This prevents premature switching of newly formed hemagglutinin to the fusion-active conformation. Notably, M2 is inhibited by antiviral drugs like amantadine and rimantadine, resulting in the incapacity of viral uncoating. However, the emergence of amantadine-resistant variants is a common occurrence and typically rapid.

Virus

E. coli Cell-free

N-10*His;C-Myc

A0A2R3YRM7 (M1-E97)

/

MSLLTEVETPTRSGWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKCIYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE

18.6 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.