MC1R-VLPs Protein, Mouse (HEK293, His)

MC1R-VLP is a receptor for MSH and ACTH and critically regulates melanogenesis by controlling the production of eumelanin and pheomelanin through G protein-mediated activation of adenylyl cyclase. This receptor interacts with MGRN1 to inhibit cAMP production by competing with GNAS binding, and with OPN3 to reduce MC1R-mediated cAMP signaling and melanin production in melanocytes. MC1R-VLPs Protein, Mouse (HEK293, His) is the recombinant mouse-derived MC1R-VLPs protein, expressed by HEK293 , with C-10*His labeled tag. The total length of MC1R-VLPs Protein, Mouse (HEK293, His) is 315 a.a., with molecular weight of 36.6 kDa.

MC1R-VLPs, serving as a receptor for MSH (alpha, beta, and gamma) and ACTH, plays a crucial role in melanogenesis by regulating the production of eumelanin (black/brown) and phaeomelanin (red/yellow) through the activation of adenylate cyclase via G proteins. The receptor interacts with MGRN1, inhibiting agonist-induced cAMP production by competing with GNAS-binding, although it does not undergo MGRN1-mediated ubiquitination. Additionally, MC1R-VLPs interacts with OPN3, resulting in a decrease in MC1R-mediated cAMP signaling and consequently reducing melanin production in melanocytes. These interactions highlight the intricate regulatory mechanisms governing melanogenesis mediated by MC1R-VLPs.

Mouse

HEK293

C-10*His

Q01727 (M1-W315)

17199

MSTQEPQKSLLGSLNSNATSHLGLATNQSEPWCLYVSIPDGLFLSLGLVSLVENVLVVIAITKNRNLHSPMYYFICCLALSDLMVSVSIVLETTIILLLEAGILVARVALVQQLDNLIDVLICGSMVSSLCFLGIIAIDRYISIFYALRYHSIVTLPRARRAVVGIWMVSIVSSTLFITYYKHTAVLLCLVTFFLAMLALMAILYAHMFTRACQHAQGIAQLHKRRRSIRQGFCLKGAATLTILLGIFFLCWGPFFLHLLLIVLCPQHPTCSCIFKNFNLFLLLIVLSSTVDPLIYAFRSQELRMTLKEVLLCSW

36.6 kDa

/

<1 EU/μg, determined by LAL method.