Membrane Protein, HCoV-NL63 (Cell-Free, His)

As a membrane protein, it crucially contributes to virus morphogenesis and assembly by interacting with viral proteins. Operating as a homomultimer, it engages with envelope E protein in the host cell's budding compartment. Additionally, it forms complexes with HE and S proteins, interacting with nucleocapsid N protein, potentially aiding RNA packaging into the virus. Membrane Protein, HCoV-NL63 (Cell-Free, His) is the recombinant Virus-derived Membrane protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of Membrane Protein, HCoV-NL63 (Cell-Free, His) is 226 a.a., with molecular weight of 28.7 kDa.

As a membrane protein, it serves as a pivotal component of the viral envelope, playing a crucial role in virus morphogenesis and assembly through interactions with other viral proteins. Operating as a homomultimer, the membrane protein engages with the envelope E protein within the host cell's budding compartment, situated between the endoplasmic reticulum and the Golgi complex. Additionally, it forms complexes with HE and S proteins, while also interacting with the nucleocapsid N protein, likely contributing to RNA packaging into the virus.

Virus

E. coli Cell-free

N-10*His

Q6Q1R9 (M1-I226)

2943503

MSNSSVPLLEVYVHLRNWNFSWNLILTLFIVVLQYGHYKYSRLLYGLKMSVLWCLWPLVLALSIFDCFVNFNVDWVFFGFSILMSIITLCLWVMYFVNSFRLWRRVKTFWAFNPETNAIISLQVYGHNYYLPVMAAPTGVTLTLLSGVLLVDGHKIATRVQVGQLPKYVIVATPSTTIVCDRVGRSVNETSQTGWAFYVRAKHGDFSGVASQEGVLSEREKLLHLI

28.7 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.