1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. MIF Protein, Mouse

MIF Protein, Mouse

Cat. No.: HY-P7388
COA Handling Instructions

MIF Protein, Mouse has assumed an important role as a pivotal regulator of innate immunity. MIF Protein, Mouse promotes the pro-inflammatory functions of immune cells.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample (2 μg)   Apply now
2 μg $30 In-stock
10 μg $70 In-stock
50 μg $175 In-stock
100 μg $280 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE MIF Protein, Mouse

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

MIF Protein, Mouse has assumed an important role as a pivotal regulator of innate immunity. MIF Protein, Mouse promotes the pro-inflammatory functions of immune cells.

Background

Macrophage Migration Inhibitory Factor (MIF) has assumed an important role as a pivotal regulator of innate immunity. MIF is an integral component of the host antimicrobial alarm system and stress response that promotes the pro-inflammatory functions of immune cells. MIF-directed therapies might offer new treatment opportunities for human diseases in the future[1].

Biological Activity

1.Measured in a cell proliferation assay using MCF-7 human breast cancer cells. The ED50 this effect is ≤10.51 ng/mL, corresponding to a specific activity is ≥9.515×104 units/mg.
2.Measured by its ability to inhibit THP-1 cells migration. The ED50 for this effect is ≤ 9.142 ng/mL, corresponding to a specific activity is ≥1.094×105 U/mg.

  • Measured in a cell proliferation assay using MCF-7 human breast cancer cells. The ED50 this effect is 3.326 ng/mL, corresponding to a specific activity is 3.006×105 units/mg.
Species

Mouse

Source

E. coli

Tag

Tag Free

Accession

P34884 (M1-A115)

Gene ID

17319  [NCBI]

Molecular Construction
N-term
MIF (M1-A115)
Accession # P34884
C-term
Synonyms
rMuMMIF; GLIF; GIF; MIF
AA Sequence

MPMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA

Molecular Weight

Approximately 11 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized after extensive dialysis against PBS or 20 mM PB, 150 mM NaCl, pH 7.4 or PBS, 1 mM DTT, pH 7.4 or PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

MIF Protein, Mouse Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MIF Protein, Mouse
Cat. No.:
HY-P7388
Quantity:
MCE Japan Authorized Agent: