MIG/CXCL9 Protein, Rabbit (His-SUMO)

MIG/CXCL9 Protein, part of the intercrine alpha family, is crucial for chemokines involved in intercellular communication and immune responses. Within this family, MIG/CXCL9 likely plays a key role in modulating inflammatory processes and influencing cellular interactions. Further investigation is essential to unveil specific functions and implications within the broader chemokine CxC family, underscoring its significance in mediating immune responses. MIG/CXCL9 Protein, Rabbit (His-SUMO) is the recombinant Rabbit-derived MIG/CXCL9 protein, expressed by E. coli, with N-SUMO, N-6*His labeled tag. The total length of MIG/CXCL9 Protein, Rabbit (His-SUMO) is 102 a.a., with molecular weight of 27.5 kDa.

The MIG/CXCL9 protein is a member of the intercrine alpha (chemokine CxC) family, indicating its involvement in a group of chemokines crucial for intercellular communication and immune responses. Within the intercrine alpha family, MIG/CXCL9 likely plays a key role in modulating inflammatory processes and influencing cellular interactions. Further investigation is essential to reveal the specific functions and implications of this protein within the broader framework of the chemokine CxC family, underscoring its significance in mediating immune responses.

Rabbit

E. coli

N-SUMO;N-6*His

U3KNX2 (S23-A124)

103350772  [NCBI]

SPIMRNGRCSCISSTQGKIHLQSLKDLKQFSPSPSCGKTEIIATKKDGTQICLNPDSTEVKELVEKWKKQSSPKKKQKKGKKQRKVKKSLKKSQRPHQKKTA

27.5 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.