MIG/CXCL9 Protein, Rabbit (His-SUMO)
The MIG/CXCL9 protein is part of the intercrine α family and is critical for chemokines involved in intercellular communication and immune responses. In this family, MIG/CXCL9 may play a key role in regulating inflammatory processes and influencing cellular interactions. MIG/CXCL9 Protein, Rabbit (His-SUMO) is the recombinant Rabbit-derived MIG/CXCL9 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.
- Species: Rabbit
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The MIG/CXCL9 protein is part of the intercrine α family and is critical for chemokines involved in intercellular communication and immune responses. In this family, MIG/CXCL9 may play a key role in regulating inflammatory processes and influencing cellular interactions. MIG/CXCL9 Protein, Rabbit (His-SUMO) is the recombinant Rabbit-derived MIG/CXCL9 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.
Background
The MIG/CXCL9 protein is a member of the intercrine alpha (chemokine CxC) family, indicating its involvement in a group of chemokines crucial for intercellular communication and immune responses. Within the intercrine alpha family, MIG/CXCL9 likely plays a key role in modulating inflammatory processes and influencing cellular interactions. Further investigation is essential to reveal the specific functions and implications of this protein within the broader framework of the chemokine CxC family, underscoring its significance in mediating immune responses.
Technical Parameters
-
Species Rabbit
-
Source E. coli
-
Tag N-SUMO;N-6*His
-
Accession
U3KNX2 (S23-A124)
-
Molecular Construction
-
N-term
-
6*His-SUMO
-
CXCL9 (S23-A124)
Accession # U3KNX2 -
C-term
-
-
Protein Length
Partial
-
Synonyms
CXCL9; Monokine Induced By Interferon-Gamma; Prev. CMK; Chemokine (C-X-C Motif) Ligand 9; Prev. MIG; Small-Inducible Cytokine B9; SCYB9; C-X-C Motif Chemokine 9; Crg-10; Alternative Protein CXCL9; Humig; HuMIG; Monokine Induced By Gamma Interferon; C-X-C
-
AA Sequence
SPIMRNGRCSCISSTQGKIHLQSLKDLKQFSPSPSCGKTEIIATKKDGTQICLNPDSTEVKELVEKWKKQSSPKKKQKKGKKQRKVKKSLKKSQRPHQKKTA
-
Predicted Molecular Mass
27.5 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
