MIG/CXCL9 Protein, Rabbit (His-SUMO)

The MIG/CXCL9 protein is part of the intercrine α family and is critical for chemokines involved in intercellular communication and immune responses. In this family, MIG/CXCL9 may play a key role in regulating inflammatory processes and influencing cellular interactions. MIG/CXCL9 Protein, Rabbit (His-SUMO) is the recombinant Rabbit-derived MIG/CXCL9 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

The MIG/CXCL9 protein is a member of the intercrine alpha (chemokine CxC) family, indicating its involvement in a group of chemokines crucial for intercellular communication and immune responses. Within the intercrine alpha family, MIG/CXCL9 likely plays a key role in modulating inflammatory processes and influencing cellular interactions. Further investigation is essential to reveal the specific functions and implications of this protein within the broader framework of the chemokine CxC family, underscoring its significance in mediating immune responses.

Rabbit

E. coli

N-SUMO;N-6*His

U3KNX2 (S23-A124)

103350772  [NCBI]

Partial

SPIMRNGRCSCISSTQGKIHLQSLKDLKQFSPSPSCGKTEIIATKKDGTQICLNPDSTEVKELVEKWKKQSSPKKKQKKGKKQRKVKKSLKKSQRPHQKKTA

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.