1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Muellerian-inhibiting factor/AMH Protein, Mouse

Muellerian-inhibiting factor/AMH Protein, Mouse

Cat. No.: HY-P72077
COA Handling Instructions

Mullerian inhibitory factor (AMH) plays a crucial role in various reproductive processes. It contributes significantly to Mullerian duct degeneration in male fetal sex differentiation. Muellerian-inhibiting factor/AMH Protein, Mouse is the recombinant mouse-derived Muellerian-inhibiting factor/AMH protein, expressed by E. coli , with tag free. The total length of Muellerian-inhibiting factor/AMH Protein, Mouse is 103 a.a., with molecular weight of ~14 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $225 In-stock
10 μg $382 In-stock
50 μg $1070 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Mullerian inhibitory factor (AMH) plays a crucial role in various reproductive processes. It contributes significantly to Mullerian duct degeneration in male fetal sex differentiation. Muellerian-inhibiting factor/AMH Protein, Mouse is the recombinant mouse-derived Muellerian-inhibiting factor/AMH protein, expressed by E. coli , with tag free. The total length of Muellerian-inhibiting factor/AMH Protein, Mouse is 103 a.a., with molecular weight of ~14 kDa.

Background

The Müllerian-inhibiting factor (AMH) protein plays a pivotal role in various reproductive processes. During male fetal sexual differentiation, it contributes significantly to Muellerian duct regression. In the adult, AMH assumes a role in Leydig cell differentiation and function. Conversely, in females, AMH acts as a negative regulator, impeding the primordial to primary follicle transition and reducing the FSH sensitivity of growing follicles. AMH exerts its effects by binding to its sole type II receptor, AMHR2, which recruits type I receptors ACVR1 and BMPR1A, subsequently activating the Smad pathway. Structurally, AMH exists as a homodimer, with disulfide linkages contributing to its stability. The diverse functions of AMH underscore its crucial involvement in orchestrating key events in both male and female reproductive development and maintenance.

Species

Mouse

Source

E. coli

Tag

Tag Free

Accession

P27106 (D450-C552)

Gene ID

11705  [NCBI]

Molecular Construction
N-term
AMH (D450-C552)
Accession # P27106
C-term
Synonyms
Amh; Muellerian-inhibiting factor; Anti-Muellerian hormone; AMH; Muellerian-inhibiting substance; MIS
AA Sequence

DKGQDGPCALRELSVDLRAERSVLIPETYQANNCQGACRWPQSDRNPRYGNHVVLLLKMQARGAALGRLPCCVPTAYAGKLLISLSEERISADHVPNMVATEC

Molecular Weight

Approximately 14 kDa.The reducing (R) protern migrat es as 14 kDa in SDS-PAGE may be due to molecular structure of protein.

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

Muellerian-inhibiting factor/AMH Protein, Mouse Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Muellerian-inhibiting factor/AMH Protein, Mouse
Cat. No.:
HY-P72077
Quantity:
MCE Japan Authorized Agent: