MYBPC3 Protein, Human (His-SUMO)
Based on 1 Customer Validation
MYBPC3 Protein, positioned in the crossbridge region of vertebrate striated muscle A bands, binds to myosin heavy chain (MHC), F-actin, and native thin filaments, influencing actin-activated myosin ATPase. Its presence suggests potential modulation of muscle contraction, indicating a functional impact on the contractile apparatus, or a structural role in muscle fibers. MYBPC3 Protein, Human (His-SUMO) is the recombinant human-derived MYBPC3 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
MYBPC3 Protein, positioned in the crossbridge region of vertebrate striated muscle A bands, binds to myosin heavy chain (MHC), F-actin, and native thin filaments, influencing actin-activated myosin ATPase. Its presence suggests potential modulation of muscle contraction, indicating a functional impact on the contractile apparatus, or a structural role in muscle fibers. MYBPC3 Protein, Human (His-SUMO) is the recombinant human-derived MYBPC3 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.
MYBPC3 Protein is a thick filament-associated protein situated in the crossbridge region of vertebrate striated muscle A bands. In vitro, it exhibits binding affinity for myosin heavy chain (MHC), F-actin, and native thin filaments, thereby influencing the activity of actin-activated myosin ATPase. Its role extends to potential modulation of muscle contraction, suggesting a functional impact on the contractile apparatus, or it may serve a structural role in the muscle fibers.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-SUMO;N-6*His
-
Accession
Q14896-1 (M1-A328)
-
Molecular Construction
-
N-term
-
6*His-SUMO
-
MYBPC3 (M1-A328)
Accession # Q14896-1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
MYBPC3; Mutant Cardiac Myosin-Binding Protein C; Prev. CMH4; Myosin-Binding Protein C Cardiac; Myosin-Binding Protein C, Cardiac-Type; Myosin-Binding Protein C; CMyBP-C; Cardiac MyBP-C; FHC; CMD1MM; Myosin Binding Protein C, Cardiac; LVNC10; C-Protein, Ca
-
AA Sequence
MPEPGKKPVSAFSKKPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQGSYAVIAGSSKVKFDLKVIEAEKAEPMLAPAPAPAEATGAPGEAPAPAAELGESAPSPKGSSSAALNGPTPGAPDDPIGLFVMRPQDGEVTVGGSITFSARVAGASLLKPPVVKWFKGKWVDLSSKVGQHLQLHDSYDRASKVYLFELHITDAQPAFTGSYRCEVSTKDKFDCSNFNLTVHEAMGTGDLDLLSAFRRTSLAGGGRRISDSHEDTGILDFSSLLKKRDSFRTPRDSKLEAPAEEDVWEILRQA
-
Predicted Molecular Mass
50.8 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)