Natriuretic peptides A/NPPA Protein, Human (P. pastoris, His)

Natriuretic peptide A/NPPA is critical for cardiorenal homeostasis and regulates vascular remodeling and energy metabolism by binding to NPR1. This stimulates the production of c, activating PRKG1 to respond differently. Natriuretic peptides A/NPPA Protein, Human (P. pastoris, His) is the recombinant human-derived Natriuretic peptides A/NPPA protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of Natriuretic peptides A/NPPA Protein, Human (P. pastoris, His) is 38 a.a., with molecular weight of 5.9 kDa.

Natriuretic peptides A/NPPA, vital in cardio-renal homeostasis, play diverse roles in vascular remodeling and energy metabolism. These peptides bind and stimulate NPR1, triggering cGMP production and activating downstream effectors, including PRKG1, to mediate various biological responses. Functionally, they regulate vasodilation, natriuresis, diuresis, and aldosterone synthesis, crucial for blood pressure regulation and fluid-electrolyte balance. In addition, they inhibit cardiac remodeling and hypertrophy by inducing cardiomyocyte apoptosis and restraining cell growth. During pregnancy, Natriuretic peptides A/NPPA promote trophoblast invasion and spiral artery remodeling, preventing pregnancy-induced hypertension. In adipose tissue, they regulate lipid metabolism and energy homeostasis through cGMP- and PKG-dependent pathways, influencing AMP-activated protein kinase (AMPK) and promoting UCP1-dependent thermogenesis in brown adipose tissue. The interaction with clearance receptor NPR3 contributes to their removal from circulation. While reports on their involvement in mammalian blood volume and pressure homeostasis vary, they enhance urine protein excretion by reducing proximal tubular protein reabsorption. Overall, Natriuretic peptides A/NPPA emerge as key players in maintaining physiological balance across multiple systems.

Human

P. pastoris

N-6*His

P01160 (P78-L115)

4878  [NCBI]

PEVPPWTGEVSPAQRDGGALGRGPWDSSDRSALLKSKL

5.9 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.