NKp46/NCR1 Protein, Mouse (HEK293, Fc)

NKp46/NCR1 Protein, a cytotoxicity-activating receptor, boosts activated natural killer (NK) cells' efficacy in eliminating tumor cells. Its interaction with CD3Z and FCER1G suggests a potential role in aiding NK cells in recognizing and destroying cancerous cells. NKp46/NCR1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived NKp46/NCR1 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of NKp46/NCR1 Protein, Mouse (HEK293, Fc) is 234 a.a., with molecular weight of ~70 kDa.

NKp46/NCR1 Protein is a cytotoxicity-activating receptor that enhances the effectiveness of activated natural killer (NK) cells in killing tumor cells. It interacts with CD3Z and FCER1G, potentially aiding in the recognition and destruction of cancerous cells by NK cells.

Mouse

HEK293

C-hFc

Q8C567 (E22-N255)

17086  [NCBI]

EKETLPKPIIWAKPSIMVTNGNSVNIWCQGAQSASEYQLYFEGSFFALERPKPSRSMNKVRFFISQMTSHTAGIYTCFYQSGELWSKSSNPLKLVVTGLYDTPNLWVYPRPEVTLGENVTFFCQLKTATSKFFLLKERGSNHIQNKYGNIQAEFPMGPVTRAHRGTYRCFGSYNDYAWSFPSEPVTLLITGGVENSSLAPTDPTSSLDYWEFDLSTNESGLQKDSAFWDHTTQN

Approximately 70 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 .

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.