1. Recombinant Proteins
  2. Receptor Proteins
  3. NKp46/NCR1 Protein, Mouse (HEK293, Fc)

NKp46/NCR1 Protein, Mouse (HEK293, Fc)

Cat. No.: HY-P70562
SDS COA Handling Instructions

NKp46/NCR1 Protein, a cytotoxicity-activating receptor, boosts activated natural killer (NK) cells' efficacy in eliminating tumor cells.Its interaction with CD3Z and FCER1G suggests a potential role in aiding NK cells in recognizing and destroying cancerous cells.NKp46/NCR1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived NKp46/NCR1 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg $100 In-stock
50 μg $280 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

NKp46/NCR1 Protein, a cytotoxicity-activating receptor, boosts activated natural killer (NK) cells' efficacy in eliminating tumor cells.Its interaction with CD3Z and FCER1G suggests a potential role in aiding NK cells in recognizing and destroying cancerous cells.NKp46/NCR1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived NKp46/NCR1 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

NKp46/NCR1 Protein is a cytotoxicity-activating receptor that enhances the effectiveness of activated natural killer (NK) cells in killing tumor cells. It interacts with CD3Z and FCER1G, potentially aiding in the recognition and destruction of cancerous cells by NK cells.

Species

Mouse

Source

HEK293

Tag

C-hFc

Accession

Q8C567 (E22-N255)

Gene ID
Molecular Construction
N-term
NKp46 (E22-N255)
Accession # Q8C567
hFc
C-term
Synonyms
Activating receptor1; mAR-1; Lymphocyte antigen94; Naturalkiller cell p46-related protein; NK-p46; NKp46; mNKp46
AA Sequence

EKETLPKPIIWAKPSIMVTNGNSVNIWCQGAQSASEYQLYFEGSFFALERPKPSRSMNKVRFFISQMTSHTAGIYTCFYQSGELWSKSSNPLKLVVTGLYDTPNLWVYPRPEVTLGENVTFFCQLKTATSKFFLLKERGSNHIQNKYGNIQAEFPMGPVTRAHRGTYRCFGSYNDYAWSFPSEPVTLLITGGVENSSLAPTDPTSSLDYWEFDLSTNESGLQKDSAFWDHTTQN

Molecular Weight

Approximately 70 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 .

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

NKp46/NCR1 Protein, Mouse (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NKp46/NCR1 Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P70562
Quantity:
MCE Japan Authorized Agent: