NNT1/CLC Protein, Human (HEK293, N-hFc)

For research use only. We do not sell to patients.

Size	Price	Stock	Quantity
20 μg	$100	In-stock	Estimated Time of Arrival: December 31
50 μg		Get quote
100 μg		Get quote

* Please select Quantity before adding items.

Species	Human
Source	HEK293
Tag	N-hFc
Accession	NP_037378.1 (L28-F225)
Gene ID	23529
Synonyms	Cardiotrophin-like cytokine factor 1; BSF-3; CLCF1; BSF3; CLC; NNT1
AA Sequence	LNRTGDPGPGPSIQKTYDLTRYLEHQLRSLAGTYLNYLGPPFNEPDFNPPRLGAETLPRATVDLEVWRSLNDKLRLTQNYEAYSHLLCYLRGLNRQAATAELRRSLAHFCTSLQGLLGSIAGVMAALGYPLPQPLPGTEPTWTPGPAHSDFLQKMDDFWLLKELQTWLWRSAKDFNRLKKKMQPPAAAVTLHLGAHGF
Molecular Weight	Approximately 53 kDa due to the glycosylation
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Appearance	Solution.
Formulation	Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.
Endotoxin Level	<1 EU/μg, determined by LAL method.
Reconstitution	N/A.
Storage & Stability	Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping	Shipping with dry ice.
Documentation	Select Batch: Data Sheet (233 KB) SDS (251 KB) COA (219 KB) Handling Instructions (2659 KB)

NNT1/CLC Protein, Human (HEK293, N-hFc) Related Classifications

Help & FAQs

Do most proteins show cross-species activity?
Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Specific Activity (Unit/mg) = 10⁶ ÷ Biological Activity (ED₅₀)

Product Name

Salutation

Applicant Name *

Email Address *

Phone Number *

Organization Name *

Department *

Requested quantity *

Country or Region *

Remarks

Name
Email *

	Sorry, but the email address you supplied was invalid.