Copy Link Print Information

Noggin Protein, Mouse (CHO)

13 Cited Publications
Customer Review

Based on 13 publication(s) in Google Scholar

Noggin protein is an important BMP inhibitor that plays an indispensable role in the neural tube, somite growth, cartilage morphogenesis, and joint formation. Its homodimeric structure promotes significant interactions with GDF5 and possibly GDF6, inhibiting chondrocyte differentiation. Noggin Protein, Mouse (CHO) is the recombinant mouse-derived Noggin protein, expressed in CHO.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: CHO
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for Noggin Protein, Mouse (CHO)
  • Experimental Validation Results for Noggin Protein, Mouse (CHO)
  • Experimental Validation Results for Noggin Protein, Mouse (CHO)
  • Experimental Validation Results for Noggin Protein, Mouse (CHO)
  • Experimental Validation Results for Noggin Protein, Mouse (CHO)
  • Experimental Validation Results for Noggin Protein, Mouse (CHO)
  • Experimental Validation Results for Noggin Protein, Mouse (CHO)
  • Noggin Protein, Mouse (CHO) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download
Related Products:

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Noggin protein is an important BMP inhibitor that plays an indispensable role in the neural tube, somite growth, cartilage morphogenesis, and joint formation. Its homodimeric structure promotes significant interactions with GDF5 and possibly GDF6, inhibiting chondrocyte differentiation. Noggin Protein, Mouse (CHO) is the recombinant mouse-derived Noggin protein, expressed in CHO.

Background

Mammalian noggin is remarkably similar in its sequence to Xenopus noggin, and is similarly active in induction assays performed on Xenopus embryo tissues. In the adult mammal, noggin is most notably expressed in the nervous system[1]. Noggin is a bone morphogenetic protein (BMP) antagonist expressed in Spemann's organizer. Murine Noggin is expressed in condensing cartilage and immature chondrocytes. In mice lacking Noggin, cartilage condensations initiated normally but developed hyperplasia, and initiation of joint development failed[2]. Noggin protein binds BMP4with high affinity and can abolish BMP4 activity by blocking binding to cognate cell-surface receptors[3]. Human Noggin (hNoggin) has 205 amino acids (residues 28–232) after removal of its signal sequence (residues 1–27) and is secreted as a glycosylated, covalently linked homodimer. Human Noggin binds with high affinity to hBMP-4 (and with lower affinity to hBMP-7[4].

In Vitro

Noggin Protein, Mouse (200 ng/mL, 10 days) induces alkaline phosphatase in human mesenchymal stem cell (HMSC), and induces mineralization in HMSC into the osteoblast phenotype[5].

In Vivo

Noggin Protein, Mouse (17.8 µg/kg/day, intrathecal administration for 2 weeks) promotes the recovery of motor function and the descending corticospinal tract (CST) regeneration in mouse spinal cord injury models[6].

Verified Bioactivity

1.Measured by its ability to inhibit BMP-4-induced alkaline phosphatase production by ATDC5 mouse chondrogenic cells. The ED50 for this effect is ≤0.1 μg/mL in the presence of 30 ng/mL of Recombinant Human BMP-4 (HY-P7007), corresponding to a specific activity is ≥1×105units/mg.
2.Measured by its ability to inhibit BMP-4-induced alkaline phosphatase production by ATDC5 mouse chondrogenic cells. The ED50 for this effect is ≤0.06 μg/mL in the presence of 10 ng/mL of Recombinant Human BMP-4 (HY-P7007), corresponding to a specific activity is ≥1.7×107units/mg.
3.Measured by its ability to inhibit BMP-4-induced alkaline phosphatase production by ATDC5 mouse chondrogenic cells. The ED50 for this effect is 0.02-0.16 μg/mL in the presence of 50 ng/mL of Recombinant Human BMP-4 (HY-P7007).

Technical Parameters

  • Species Mouse
  • Source CHO
  • Tag Tag Free
  • Accession

    P97466 (L20-C232)

  • Gene ID
    18121  [NCBI]
  • Molecular Construction
    • N-term
    • Noggin (L20-C232)
      Accession # P97466
    • C-term
  • Protein Length

    Partial

  • Synonyms

    NOG; Symphalangism 1 (Proximal); Prev. SYNS1; SYNS1A; Prev. SYM1; Noggin; Synostoses (Multiple) Syndrome 1

  • AA Sequence

    LRAAPAGGQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC

  • Predicted Molecular Mass

    23.8 kDa

  • Molecular Weight

    Approximately 28-31 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
4.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 500 mM NaCl , pH 7.4, 5% trehalose, mannitol, 0.01% Tween 80.
4.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Valenzuela DM, et al. Identification of mammalian noggin and its expression in the adult nervous system. J Neurosci. 1995 Sep;15(9):6077-84. [Content Brief]

[2]. Brunet LJ, et al. Noggin, cartilage morphogenesis, and joint formation in the mammalian skeleton. Science. 1998 May 29;280(5368):1455-7. [Content Brief]

[3]. Smith WC, et al. Secreted noggin protein mimics the Spemann organizer in dorsalizing Xenopus mesoderm. Nature. 1993 Feb 11;361(6412):547-9. [Content Brief]

[4]. Groppe J, et al. Structural basis of BMP signalling inhibition by the cystine knot protein Noggin. Nature. 2002 Dec 12;420(6916):636-42. [Content Brief]

[5]. Rifas L. The role of noggin in human mesenchymal stem cell differentiation. J Cell Biochem. 2007 Mar 1;100(4):824-34. [Content Brief]

[6]. Matsuura I, et al., BMP inhibition enhances axonal growth and functional recovery after spinal cord injury. J Neurochem. 2008 May;105(4):1471-9 [Content Brief]

View More

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to inhibit BMP-4-induced alkaline phosphatase production by ATDC5 mouse chondrogenic cells. The ED50 for this effect is 0.0868 μg/mL in the presence of 30 ng/mL of Recombinant Human BMP-4, corresponding to a specific activity is 1.152×104 units/mg.

  • 1/16

    Noggin Protein, Mouse (CHO) purchased from MedChemExpress. Usage Cited in: Acta Pharm Sin B. 2025 Sep;15(9):4711-4729. [Abstract]

    Customer Validation
     Timeline and scheme of combined treatment with BLM, Met and Noggin Protein or Oleuropein. The mice were sacrificed at dpi28 after BLM injury and were i.t. injected with EDU the day before sacrifice.

  • 1/16

    Noggin Protein, Mouse (CHO) purchased from MedChemExpress. Usage Cited in: Acta Pharm Sin B. 2025 Sep;15(9):4711-4729. [Abstract]

    Customer Validation
     Met alone did not significantly alter the expression of Bmp2 or Pparg in the lung tissue of control mice, but Noggin or BLM treatment significantly reduced their expression levels.

  • 1/16

    Noggin Protein, Mouse (CHO) purchased from MedChemExpress. Usage Cited in: ACS Pharmacol Transl Sci. 2024 Jun 24;7(7):1951-1970. [Abstract]

    Customer Validation
     We evaluated the phosphorylation of SMAD1/5/9 by BMPSB4 compared to that by the BMP4 recombinant protein in the presence of NOGGIN (200 ng/mL), a BMP4 signaling pathway inhibitor.

  • 1/16

    Noggin Protein, Mouse (CHO) purchased from MedChemExpress. Usage Cited in: ACS Pharmacol Transl Sci. 2024 Jun 24;7(7):1951-1970. [Abstract]

    Customer Validation
     200 ng/mL NOGGIN completely blocked the phosphorylation of SMAD1/5/9 induced by 100 ng/mL BMP4 but had no effect on the phosphorylation of SMAD1/5/9 induced by BMPSB4.

  • 1/16

    Noggin Protein, Mouse (CHO) purchased from MedChemExpress. Usage Cited in: ACS Pharmacol Transl Sci. 2024 Jun 24;7(7):1951-1970. [Abstract]

    Customer Validation
     Comparison of the inhibitory effects of BMP4 and BMPSB4, and the effect of NOGGIN (200 ng/mL, 0-96 h) on these inhibitory effects. Cell viability was assessed via the CCK-8 assay.

  • Noggin Protein, Mouse (CHO) Product Image
    1/16
  • Experimental Validation Results for Noggin Protein, Mouse (CHO)
  • Experimental Validation Results for Noggin Protein, Mouse (CHO)
  • Experimental Validation Results for Noggin Protein, Mouse (CHO)
  • Experimental Validation Results for Noggin Protein, Mouse (CHO)
  • Experimental Validation Results for Noggin Protein, Mouse (CHO)
  • Experimental Validation Results for Noggin Protein, Mouse (CHO)
  • Experimental Validation Results for Noggin Protein, Mouse (CHO)
  • Noggin Protein, Mouse (CHO) Product Image

  • Noggin Protein, Mouse (CHO) purchased from MedChemExpress. Usage Cited in: Acta Pharm Sin B. 2025 Sep;15(9):4711-4729. [Abstract]

    Timeline and scheme of combined treatment with BLM, Met and Noggin Protein or Oleuropein. The mice were sacrificed at dpi28 after BLM injury and were i.t. injected with EDU the day before sacrifice.

  • Noggin Protein, Mouse (CHO) purchased from MedChemExpress. Usage Cited in: Acta Pharm Sin B. 2025 Sep;15(9):4711-4729. [Abstract]

    Met alone did not significantly alter the expression of Bmp2 or Pparg in the lung tissue of control mice, but Noggin or BLM treatment significantly reduced their expression levels.

  • Noggin Protein, Mouse (CHO) purchased from MedChemExpress. Usage Cited in: ACS Pharmacol Transl Sci. 2024 Jun 24;7(7):1951-1970. [Abstract]

    We evaluated the phosphorylation of SMAD1/5/9 by BMPSB4 compared to that by the BMP4 recombinant protein in the presence of NOGGIN (200 ng/mL), a BMP4 signaling pathway inhibitor.

  • Noggin Protein, Mouse (CHO) purchased from MedChemExpress. Usage Cited in: ACS Pharmacol Transl Sci. 2024 Jun 24;7(7):1951-1970. [Abstract]

    200 ng/mL NOGGIN completely blocked the phosphorylation of SMAD1/5/9 induced by 100 ng/mL BMP4 but had no effect on the phosphorylation of SMAD1/5/9 induced by BMPSB4.

  • Noggin Protein, Mouse (CHO) purchased from MedChemExpress. Usage Cited in: ACS Pharmacol Transl Sci. 2024 Jun 24;7(7):1951-1970. [Abstract]

    Comparison of the inhibitory effects of BMP4 and BMPSB4, and the effect of NOGGIN (200 ng/mL, 0-96 h) on these inhibitory effects. Cell viability was assessed via the CCK-8 assay.