1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Noggin Protein, Mouse (CHO)

Noggin protein is an important BMP inhibitor that plays an indispensable role in the neural tube, somite growth, cartilage morphogenesis, and joint formation. Its homodimeric structure promotes significant interactions with GDF5 and possibly GDF6, inhibiting chondrocyte differentiation. Noggin Protein, Mouse (CHO) is the recombinant mouse-derived Noggin protein, expressed in CHO.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

    Noggin Protein, Mouse (CHO) purchased from MCE. Usage Cited in: Acta Pharm Sin B. 2025 Sep;15(9):4711-4729.  [Abstract]

    Timeline and scheme of combined treatment with BLM, Met and Noggin Protein or Oleuropein. The mice were sacrificed at dpi28 after BLM injury and were i.t. injected with EDU the day before sacrifice.

    Noggin Protein, Mouse (CHO) purchased from MCE. Usage Cited in: Acta Pharm Sin B. 2025 Sep;15(9):4711-4729.  [Abstract]

    Met alone did not significantly alter the expression of Bmp2 or Pparg in the lung tissue of control mice, but Noggin or BLM treatment significantly reduced their expression levels.

    Noggin Protein, Mouse (CHO) purchased from MCE. Usage Cited in: ACS Pharmacol Transl Sci. 2024 Jun 24;7(7):1951-1970.  [Abstract]

    We evaluated the phosphorylation of SMAD1/5/9 by BMPSB4 compared to that by the BMP4 recombinant protein in the presence of NOGGIN (200 ng/mL), a BMP4 signaling pathway inhibitor.

    Noggin Protein, Mouse (CHO) purchased from MCE. Usage Cited in: ACS Pharmacol Transl Sci. 2024 Jun 24;7(7):1951-1970.  [Abstract]

    200 ng/mL NOGGIN completely blocked the phosphorylation of SMAD1/5/9 induced by 100 ng/mL BMP4 but had no effect on the phosphorylation of SMAD1/5/9 induced by BMPSB4.

    Noggin Protein, Mouse (CHO) purchased from MCE. Usage Cited in: ACS Pharmacol Transl Sci. 2024 Jun 24;7(7):1951-1970.  [Abstract]

    Comparison of the inhibitory effects of BMP4 and BMPSB4, and the effect of NOGGIN (200 ng/mL, 0-96 h) on these inhibitory effects. Cell viability was assessed via the CCK-8 assay.
    • Biological Activity

    • Technical Parameters

    • Properties

    • Documentation

    • References

    Description

    Noggin protein is an important BMP inhibitor that plays an indispensable role in the neural tube, somite growth, cartilage morphogenesis, and joint formation. Its homodimeric structure promotes significant interactions with GDF5 and possibly GDF6, inhibiting chondrocyte differentiation. Noggin Protein, Mouse (CHO) is the recombinant mouse-derived Noggin protein, expressed in CHO.

    Background

    Mammalian noggin is remarkably similar in its sequence to Xenopus noggin, and is similarly active in induction assays performed on Xenopus embryo tissues. In the adult mammal, noggin is most notably expressed in the nervous system[1]. Noggin is a bone morphogenetic protein (BMP) antagonist expressed in Spemann's organizer. Murine Noggin is expressed in condensing cartilage and immature chondrocytes. In mice lacking Noggin, cartilage condensations initiated normally but developed hyperplasia, and initiation of joint development failed[2]. Noggin protein binds BMP4with high affinity and can abolish BMP4 activity by blocking binding to cognate cell-surface receptors[3]. Human Noggin (hNoggin) has 205 amino acids (residues 28–232) after removal of its signal sequence (residues 1–27) and is secreted as a glycosylated, covalently linked homodimer. Human Noggin binds with high affinity to hBMP-4 (and with lower affinity to hBMP-7[4].

    In Vitro

    Noggin Protein, Mouse (200 ng/mL, 10 days) induces alkaline phosphatase in human mesenchymal stem cell (HMSC), and induces mineralization in HMSC into the osteoblast phenotype[5].

    In Vivo

    Noggin Protein, Mouse (17.8 µg/kg/day, intrathecal administration for 2 weeks) promotes the recovery of motor function and the descending corticospinal tract (CST) regeneration in mouse spinal cord injury models[6].

    Biological Activity

    1.Measured by its ability to inhibit BMP-4-induced alkaline phosphatase production by ATDC5 mouse chondrogenic cells. The ED50 for this effect is ≤0.01 μg/mL in the presence of 30 ng/mL of Recombinant Human BMP-4 (HY-P7007), corresponding to a specific activity is ≥1×105units/mg.
    2.Measured by its ability to inhibit BMP-4-induced alkaline phosphatase production by ATDC5 mouse chondrogenic cells. The ED50 for this effect is ≤0.06 μg/mL in the presence of 10 ng/mL of Recombinant Human BMP-4 (HY-P7007), corresponding to a specific activity is ≥1.7×107units/mg.
    3.Measured by its ability to inhibit BMP-4-induced alkaline phosphatase production by ATDC5 mouse chondrogenic cells. The ED50 for this effect is 0.02-0.16 μg/mL in the presence of 50 ng/mL of Recombinant Human BMP-4 (HY-P7007).

    • Measured by its ability to inhibit BMP-4-induced alkaline phosphatase production by ATDC5 mouse chondrogenic cells. The ED50 for this effect is 0.0868 μg/mL in the presence of 30 ng/mL of Recombinant Human BMP-4, corresponding to a specific activity is 1.152×104 units/mg.
    Species

    Mouse

    Source

    CHO

    Tag

    Tag Free

    Accession

    P97466 (L20-C232)

    Gene ID
    Molecular Construction
    N-term
    Noggin (L20-C232)
    Accession # P97466
    C-term
    Protein Length

    Partial

    Synonyms
    rMuNoggin; NOG
    AA Sequence

    LRAAPAGGQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC

    Molecular Weight

    Approximately 28-31 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

    Glycosylation
    Yes
    Purity
    • ≥ 95%, as determined by reducing SDS-PAGE.
    Appearance

    Lyophilized powder

    Formulation

    1.Lyophilized from a 0.22 μm filtered solution of PBS.
    2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
    3.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 500 mM NaCl , pH 7.4, 5% trehalose, mannitol, 0.01% Tween 80.
    4.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
    Please refer to the lot-specific COA for specific buffer information.

    Endotoxin Level

    <0.2 EU/μg, determined by LAL method.

    Reconstitution

    It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

    Storage & Stability

    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

    Shipping

    Room temperature in continental US; may vary elsewhere.

    Documentation
    References

    Noggin Protein, Mouse (CHO) Related Classifications

    Help & FAQs
    • Do most proteins show cross-species activity?

      Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

    • Reconstitution Calculator

    • Dilution Calculator

    • Specific Activity Calculator

    The reconstitution calculator equation

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
    = ÷

    The dilution calculator equation

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

    This equation is commonly abbreviated as: C1V1 = C2V2

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
    × = ×
    C1   V1   C2   V2

    The specific activity calculator equation

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
    Unit/mg = 106 ÷ ng/mL

    Your Recently Viewed Products:

    Inquiry Online

    Your information is safe with us. * Required Fields.

    Noggin Protein, Mouse (CHO)

     

    Requested Quantity *

    Applicant Name *

     

    Salutation

    Email Address *

     

    Phone Number *

    Department

     

    Organization Name *

    City

    State

    Country or Region *

         

    Remarks

    Bulk Inquiry

    Inquiry Information

    Product Name:
    Noggin Protein, Mouse (CHO)
    Cat. No.:
    HY-P7086
    Quantity:
    MCE Japan Authorized Agent: