1. Recombinant Proteins
  2. Noggin Protein, Mouse (CHO)

Noggin Protein, Mouse (CHO)

Cat. No.: HY-P7086
Handling Instructions

Noggin Protein, Mouse (CHO) is a bone morphogenetic protein (BMP) antagonist.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $120 In-stock
Estimated Time of Arrival: December 31
50 μg $460 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Publications Citing Use of MCE Noggin Protein, Mouse (CHO)

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rMuNoggin; NOG
Species

Mouse

Source

CHO

Accession

P97466 (L20-C232)

Gene ID

18121

Molecular Weight

29-31 kDa

AA Sequence

LRAAPAGGQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC

Biological Activity
The ED50 is <60 ng/mL as measured by ATDC5 cells.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or PBS.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Mammalian noggin is remarkably similar in its sequence to Xenopus noggin, and is similarly active in induction assays performed on Xenopus embryo tissues. In the adult mammal, noggin is most notably expressed in the nervous system[1]. Noggin is a bone morphogenetic protein (BMP) antagonist expressed in Spemann's organizer. Murine Noggin is expressed in condensing cartilage and immature chondrocytes. In mice lacking Noggin, cartilage condensations initiated normally but developed hyperplasia, and initiation of joint development failed[2]. Noggin protein binds BMP4with high affinity and can abolish BMP4 activity by blocking binding to cognate cell-surface receptors[3]. Human Noggin (hNoggin) has 205 amino acids (residues 28–232) after removal of its signal sequence (residues 1–27) and is secreted as a glycosylated, covalently linked homodimer. Human Noggin binds with high affinity to hBMP-4 (and with lower affinity to hBMP-7[4].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Noggin Protein, Mouse (CHO)
Cat. No.:
HY-P7086
Quantity:
MCE Japan Authorized Agent: