Nucleophosmin/Npm1 Protein, Mouse (His-SUMO)

Customer Review

Based on 1 Customer Validation

The nucleophosmin/Npm1 protein is a multifunctional nucleolar phosphoprotein involved in multiple cellular processes, including ribosome assembly and transport, DNA repair, and centrosome duplication.It plays a crucial role in maintaining genome stability and regulating cell proliferation.Nucleophosmin/Npm1 Protein, Mouse (His-SUMO) is the recombinant mouse-derived Nucleophosmin/Npm1 protein, expressed by E.coli , with N-His, N-SUMO labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The nucleophosmin/Npm1 protein is a multifunctional nucleolar phosphoprotein involved in multiple cellular processes, including ribosome assembly and transport, DNA repair, and centrosome duplication.It plays a crucial role in maintaining genome stability and regulating cell proliferation.Nucleophosmin/Npm1 Protein, Mouse (His-SUMO) is the recombinant mouse-derived Nucleophosmin/Npm1 protein, expressed by E.coli , with N-His, N-SUMO labeled tag.

Background

Nucleophosmin/Npm1 is a multifunctional protein engaged in various cellular processes, including ribosome biogenesis, centrosome duplication, protein chaperoning, histone assembly, cell proliferation, and the regulation of tumor suppressors such as p53/TP53 and ARF. Its involvement in driving ribosome nuclear export is associated with its binding to ribosomes, while it forms complexes with nucleolar ribonucleoprotein structures and binds single-stranded nucleic acids. Acting as a chaperonin for core histones H3, H2B, and H4, Npm1 stimulates APEX1 endonuclease activity on double-stranded DNA but inhibits it on single-stranded RNA. Additionally, it plays a role in controlling APEX1 endonuclease activity within nucleoli, contributing to the repair of apurinic/apyrimidinic sites on rDNA and the removal of oxidized rRNA molecules. Npm1 is implicated in centrosome and centriole duplication, negatively regulating EIF2AK2/PKR activation to suppress apoptosis. Furthermore, it interacts with various proteins, such as MYC, NSUN2, SENP3, and NEK2, highlighting its diverse molecular partnerships and functional versatility. The protein forms a decamer with disulfide-linked dimers under specific conditions and participates in complexes like the SWAP complex, emphasizing its dynamic engagement in cellular processes.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag N-His;N-SUMO
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His-SUMO
    • Npm1 (M1-L292)
      Accession # Q61937
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    NPM1; Numatrin; Nucleophosmin 1; B23; Nucleophosmin; Nucleophosmin (Nucleolar Phosphoprotein B23, Numatrin); NPM; Nucleophosmin/Nucleoplasmin Family, Member 1; Nucleolar Phosphoprotein B23; Testicular Tissue Protein Li 128; Nucleolar Protein NO38; Mutant

  • AA Sequence

    MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGKRSAPGGGNKVPQKKVKLDEDDEDDDEDDEDDEDDDDDDFDEEETEEKVPVKKSVRDTPAKNAQKSNQNGKDLKPSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL

  • Predicted Molecular Mass

    48.6 kDa

  • Molecular Weight

    Approximately 58 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl,0.5 M NaCl, 6% trehalose, pH 8.0.
2.Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00