O-acyltransferase Protein, Zea mays (Cell-Free, His)

O-acyltransferase Proteins play a crucial role in glycerolipid metabolism, particularly in the synthesis of triacylglycerol. These enzymes are essential for lipid metabolism, enabling the cell to convert and synthesize important lipid molecules. O-acyltransferase Protein, Zea mays (Cell-Free, His) is the recombinant O-acyltransferase protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of O-acyltransferase Protein, Zea mays (Cell-Free, His) is 494 a.a., with molecular weight of 57.8 kDa.

O-acyltransferase is a key player in glycerolipid metabolism, specifically involved in the biosynthesis of triacylglycerol. This enzyme holds a pivotal role in lipid metabolism, facilitating the conversion and synthesis of important lipid molecules within the cell.

Others

E. coli Cell-free

N-10*His

B0LF77 (M1-R494)

103629820

MAPPPSMPAASDRAGPGRDAGDSSSLRLRRAPSADAGDLAGDSSGGLRENGEPQSPTNPPPQEQQQHEMLYYRASAPAHRRVKESPLSSDAIFRQSHAGLLNLCIVVLIAVNSRLIIENLMKYGLLIRAGFWFSARSLGDWPLLMCCLTLPVFPLVALMAEKLITRKLIGEHVVILLHIIITTSAIVYPVVVTLKCDSAVLSGFVLMFLASIMWMKLVSYAHTNYDIRVLSKSTEKGAAYGNYVDPENMKDPTFKSLVYFMLAPTLCYQPTYPQTTCIRKGWVTQQLIKCVVFTGLMGFIIEQYINPIVKNSKHPLKGNFLNAIERVLKLSVPTLYVWLCMFYCFFHLWLNIVAELLCFGDREFYKDWWNAKTVEEYWRMWNMPVHKWIIRHIYFPCIRKGFSRGVAILISFLVSAVFHEICIAVPCHIFKFWAFSGIMFQIPLVFLTRYLHATFKHVMVGNMIFWFFFSIVGQPMCVLLYYHDVMNRQAQASR

57.8 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.