Odorant-binding protein/OBP Protein, Bovine (P.pastoris)
Odor-binding proteins (OBPs) effectively bind a variety of odorants to form homodimers that enhance their function. OBP is crucial in the olfactory process, playing a key role in capturing odor molecules and contributing to the complex odor perception mechanism. Odorant-binding protein/OBP Protein, Bovine (P.pastoris) is the recombinant bovine-derived Odorant-binding protein/OBP protein, expressed by P. pastoris , with tag free.
- Species: Bovine
- Source: P. pastoris
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Odor-binding proteins (OBPs) effectively bind a variety of odorants to form homodimers that enhance their function. OBP is crucial in the olfactory process, playing a key role in capturing odor molecules and contributing to the complex odor perception mechanism. Odorant-binding protein/OBP Protein, Bovine (P.pastoris) is the recombinant bovine-derived Odorant-binding protein/OBP protein, expressed by P. pastoris , with tag free.
Background
The Odorant-binding protein (OBP) is characterized by its ability to bind a diverse range of chemical odorants. Structurally, it forms homodimers, underscoring its functional organization. As an essential component in olfactory processes, OBP plays a pivotal role in recognizing and capturing various odor molecules, contributing to the intricate mechanisms underlying the perception of scents. This homodimeric configuration likely enhances its efficiency in binding and transporting a wide spectrum of odorants, highlighting the significance of OBP in facilitating olfactory signaling and sensory perception.
Technical Parameters
-
Species Bovine
-
Source P. pastoris
-
Tag Tag Free
-
Accession
P07435 (A1-E159)
-
Gene ID/
-
Molecular Construction
-
N-term
-
OBP (A1-E159)
Accession # P07435 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
Odorant-binding protein; OBP; Olfactory mucosa pyrazine-binding protein
-
AA Sequence
AQEEEAEQNLSELSGPWRTVYIGSTNPEKIQENGPFRTYFRELVFDDEKGTVDFYFSVKRDGKWKNVHVKATKQDDGTYVADYEGQNVFKIVSLSRTHLVAHNINVDKHGQTTELTELFVKLNVEDEDLEKFWKLTEDKGIDKKNVVNFLENEDHPHPE
-
Predicted Molecular Mass
34.5 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
