2. Recombinant Proteins
  3. Viral Proteins
  4. OPG081 Protein, Vaccinia virus (Cell-Free, His, SUMO)

OPG081 Protein, Vaccinia virus (Cell-Free, His, SUMO)

Cat. No.: HY-P702397
Handling Instructions

OPG081 operates as an envelope protein. OPG081 Protein, Vaccinia virus (Cell-Free, His, SUMO) is the recombinant Virus-derived OPG081 protein, expressed by E. coli Cell-free, with N-6*His, N-SUMO labeled tag. The total length of OPG081 Protein, Vaccinia virus (Cell-Free, His, SUMO) is 78 a.a., with molecular weight of 24.6 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

OPG081 operates as an envelope protein. OPG081 Protein, Vaccinia virus (Cell-Free, His, SUMO) is the recombinant Virus-derived OPG081 protein, expressed by E. coli Cell-free, with N-6*His, N-SUMO labeled tag. The total length of OPG081 Protein, Vaccinia virus (Cell-Free, His, SUMO) is 78 a.a., with molecular weight of 24.6 kDa.
Background

OPG081 functions as an envelope protein.
Species

Virus
Source

E. coli Cell-free
Tag

N-6*His;N-SUMO
Accession

P12924 (V2-S79)
Gene ID

3707607
Molecular Construction
N-term
6*His-SUMO
OPG081 (V2-S79)
Accession # P12924
C-term
Synonyms
Protein OPG081; Protein I5; Protein VP13K
AA Sequence

VDAITVLTAIGITVLMLLMVISGAALIVKELNPNDIFTMQSLKFNRAVTIFKYIGLFIYIPGTIILYATYVKSLLMKS

Molecular Weight

24.6 kDa
Purity

Greater than 90% as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)

OPG081 Protein, Vaccinia virus (Cell-Free, His, SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
OPG081 Protein, Vaccinia virus (Cell-Free, His, SUMO)
Cat. No.:
HY-P702397
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.