P2RY12 Protein, Human (Cell-Free, His)

P2RY12 Protein, a receptor for adenosine diphosphate (ADP) and adenosine triphosphate (ATP), inhibits the adenylyl cyclase second messenger system via G-proteins. Unlike uridine diphosphate (UDP) and uridine triphosphate (UTP), P2RY12 crucially regulates platelet aggregation and blood coagulation, serving as a key regulator in these physiological processes. P2RY12 Protein, Human (Cell-Free, His) is the recombinant human-derived P2RY12 protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of P2RY12 Protein, Human (Cell-Free, His) is 342 a.a., with molecular weight of 42.2 kDa.

The P2RY12 Protein functions as a receptor for adenosine diphosphate (ADP) and adenosine triphosphate (ATP), coupled to G-proteins that inhibit the adenylyl cyclase second messenger system. This receptor is not activated by uridine diphosphate (UDP) and uridine triphosphate (UTP). P2RY12 plays a crucial role in normal platelet aggregation and blood coagulation processes, serving as a key component in the regulation of these essential physiological functions.

Human

E. coli Cell-free

N-10*His

Q9H244 (M1-M342)

64805

MQAVDNLTSAPGNTSLCTRDYKITQVLFPLLYTVLFFVGLITNGLAMRIFFQIRSKSNFIIFLKNTVISDLLMILTFPFKILSDAKLGTGPLRTFVCQVTSVIFYFTMYISISFLGLITIDRYQKTTRPFKTSNPKNLLGAKILSVVIWAFMFLLSLPNMILTNRQPRDKNVKKCSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYRSYVRTRGVGKVPRKKVNVKVFIIIAVFFICFVPFHFARIPYTLSQTRDVFDCTAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM

42.2 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.